UniGene Name: sp_v2.0_unigene81945
Length: 184 nt
Origin of reads:
![]() |
---|
>sp_v2.0_unigene81945
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Cycas revoluta RepID=Q56GG4_CYCRE | - | - | 7.0e-23 | 81% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Blast2go | reverse transcriptase | - | - | 1.25143e-30 | 86% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWN2
Fln msg: your sequence is shorter than subject: 37 - 66
Fln protein:
E
Protein Length:
38
Fln nts:
A
Fln Alignment:
AllPineV4_rep_c138968___LNKLTIKDKFPIPVIDELLDELHGSIYFTRLDLRS*YHQIRM
A9NWN2_______________LNEITIKDKFHISIVDELLDELYGTMYFLELDQKSNYYHIRV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain