|
||||||
|
UniGene Name: sp_v2.0_unigene79269
Length: 143 nt
 UniGene Fasta
|
|---|
| >sp_v2.0_unigene79269
C |
|
Ace file of the UniGene sp_v2.0_unigene79269
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | wall-associated kinase 4-like [Oryza sativa Japonica Group] dbj|BAG94677.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 1.0e-11 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
| Blast2go | wall-associated kinase 4-like | - | - | 2.88016e-18 | 86% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWR4
Fln msg: Distance to subject end: 192 aas, your sequence is shorter than subject: 47 - 402
Fln protein:
L
Protein Length:
48
Fln nts:
C
Fln Alignment:
AllPineV4_rep_c125403___LAFLHS-LHPPILHRDVKSSNILLDEDFNVKVADFGLCRLVPDNATHV
A9NWR4_______________LSYLHEELVPHIVHRDIKASNVLLDRDLNPKIADFGLAKLFPDNVTHI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
