SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene77261

Length: 369 nt

Origin of reads: Uagpf v2

UniGene Fasta

>sp_v2.0_unigene77261
CGTCGTGACCTTGGCTGTCACTCAAACAGGCGTCAAGCGCGTTGTCTTTACGTCTTCTATCGGTGCAGTTTACATGGATCCTCACAGAGAACCACTTGCTATCAGTCAAATGATGACTGCTGGAGCGATTTGGACTACTGCATACAGACCAAGAATTGGTATTGCTATGCAAAAACATTGGCAGAGAAATCCGCATGGGAGATTTCCGAGAGAAGGAATTTAGAGCTTGTGGTGATTAATCCAGGCCTGGTTTTAGGTCCCTTGTTGCAGAACGCCATGAACCCCAGCACTGCTCATATTATGAAATACTTGTCAGGATCTGCTAAGACGTATGCGAACTTAACACAGGTATATGTAGACGTGAGGGAC

Ace file of the UniGene sp_v2.0_unigene77261

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	cinnamoyl CoA reductase, putative [Arabidopsis thaliana]	-	-	6.0e-37	68%
FL-Next	tr=Cinnamoyl-CoA reductase; Pinus taeda (Loblolly pine).	-	-	0.0	73%
Blast2go	cinnamoyl- reductase	-	-	0.0	84%

Source	ECs	Term	Type	e value	Identity
Blast2go	Cinnamoyl-CoA reductase.	EC:1.2.1.44	-	0.0	84%

Source	KEGGs	Term	Identity
Blast2go	Phenylpropanoid biosynthesis	00940	84%
Blast2go	Biosynthesis of phenylpropanoids	01061	84%
Blast2go	Metabolic pathways	01100	84%
Blast2go	Biosynthesis of secondary metabolites	01110	84%

Source	GOs	Term	Type	Identity
Blast2go	DNA duplex unwinding	GO:0032508	Biological Process	84%
Blast2go	carotenoid biosynthetic process	GO:0016117	Biological Process	84%
Blast2go	regulation of stomatal movement	GO:0010119	Biological Process	84%
Blast2go	etioplast organization	GO:0009662	Biological Process	84%
Blast2go	mRNA export from nucleus	GO:0006406	Biological Process	84%
Blast2go	response to salt stress	GO:0009651	Biological Process	84%
Blast2go	response to zinc ion	GO:0010043	Biological Process	84%
Blast2go	vegetative to reproductive phase transition of meristem	GO:0010228	Biological Process	84%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	84%
Blast2go	response to cold	GO:0009409	Biological Process	84%
Blast2go	innate immune response	GO:0045087	Biological Process	84%
Blast2go	RNA secondary structure unwinding	GO:0010501	Biological Process	84%
Blast2go	circadian rhythm	GO:0007623	Biological Process	84%
Blast2go	protein kinase activity	GO:0004672	Molecular Function	84%
Blast2go	single-stranded DNA binding	GO:0003697	Molecular Function	84%
Blast2go	cinnamoyl-CoA reductase activity	GO:0016621	Molecular Function	84%
Blast2go	carotenoid isomerase activity	GO:0046608	Molecular Function	84%
Blast2go	RNA binding	GO:0003723	Molecular Function	84%
Blast2go	double-stranded DNA binding	GO:0003690	Molecular Function	84%
Blast2go	protein homodimerization activity	GO:0042803	Molecular Function	84%
Blast2go	chloroplast	GO:0009507	Cellular Component	84%
Blast2go	peroxisome	GO:0005777	Cellular Component	84%
Blast2go	nucleus	GO:0005634	Cellular Component	84%

Source	InterPros	Term	Type	Identity
Sma3	NAD-dependent epimerase/dehydratase	IPR001509	-	-
Sma3	3-beta hydroxysteroid dehydrogenase/isomerase	IPR002225	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q8VZH7

Fln msg: Separated hits, possible frame ERROR between 91 and 109, Distance to subject end: 94 aas, your sequence is shorter than subject: 123 - 324

Fln protein: VVTLAVTQTGVKRVVFTSSIGAVYMDPHRxxxxxxxNDDCWSDLDYCIQTKNWYCYAKTLAEKSAWEISERRNLELVVINPGLVLGPLLQNAMNPSTAHIMKYLSGSAKTYANLTQVYVDVRD

Protein Length: 124

Fln nts: CGTCGTGACCTTGGCTGTCACTCAAACAGGCGTCAAGCGCGTTGTCTTTACGTCTTCTATCGGTGCAGTTTACATGGATCCTCACAGAGAxxxxxxxxxxxxxxxxxxAAATGATGACTGCTGGAGCGATTTGGACTACTGCATACAGACCAAGAATTGGTATTGCTATGCAAAAACATTGGCAGAGAAATCCGCATGGGAGATTTCCGAGAGAAGGAATTTAGAGCTTGTGGTGATTAATCCAGGCCTGGTTTTAGGTCCCTTGTTGCAGAACGCCATGAACCCCAGCACTGCTCATATTATGAAATACTTGTCAGGATCTGCTAAGACGTATGCGAACTTAACACAGGTATATGTAGACGTGAGGGAC

Fln Alignment:

AllPineV4_rep_c115347___AVTQTGVKRVVFTSSIGAVYMDPHRExxxxxxNDDCWSDLDYCIQTKNWYCYAKTLAEKSAWEISERRNLELVVINPGLVLGPLLQNAMNPSTAHIMKYLSGSAKTYANLTQVYVDVRD
Q8VZH7_______________ACAVAGVRRVVFTSSIGAVYMDPSRDxxxxxxDENCWSNLDYCKETKNWYCYGKTVAEKAAWERAKDKGLDLVVVNPCVVLGPVLQSSINSSIIHILKYLTGSAKTYANSVQAYVHVRD

SNPs (tot: 8)

Position	A %	C %	G %	T %	Probability
84	60		40		1.0
85		60		40	1.0
86	60	40			1.0
88	60			40	1.0
95		50		50	1.0
97			40	60	1.0
101	60		40		1.0
105		40	60		1.0

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain

Position	A %	C %	G %	T %	Probability
84	60		40		1.0
85		60		40	1.0
86	60	40			1.0
88	60			40	1.0
95		50		50	1.0
97			40	60	1.0
101	60		40		1.0
105		40	60		1.0

Position	A %	C %	G %	T %	Probability
84	60		40		1.0
85		60		40	1.0
86	60	40			1.0
88	60			40	1.0
95		50		50	1.0
97			40	60	1.0
101	60		40		1.0
105		40	60		1.0

Position	A %	C %	G %	T %	Probability
84	60		40		1.0
85		60		40	1.0
86	60	40			1.0
88	60			40	1.0
95		50		50	1.0
97			40	60	1.0
101	60		40		1.0
105		40	60		1.0