|
||||||
|
UniGene Name: sp_v2.0_unigene74851
Length: 228 nt
Origin of reads:
 UniGene Fasta
|
|---|
| >sp_v2.0_unigene74851
A |
|
Ace file of the UniGene sp_v2.0_unigene74851
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aspartate aminotransferase n=8 Tax=Pinaceae RepID=C0PSV4_PICSI | - | - | 2.0e-15 | 97% |
| FL-Next | sp=Aspartate aminotransferase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
| Blast2go | aspartate transaminase | - | - | 1.76158e-15 | 95% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Aspartate transaminase. | EC:2.6.1.1 | - | 1.76158e-15 | 95% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | nitrogen compound metabolic process | GO:0006807 | Biological Process | 1.76158e-15 | 95% |
| Blast2go | copper ion binding | GO:0005507 | Molecular Function | 1.76158e-15 | 95% |
| Blast2go | L-aspartate:2-oxoglutarate aminotransferase activity | GO:0004069 | Molecular Function | 1.76158e-15 | 95% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 1.76158e-15 | 95% |
| Blast2go | cell wall | GO:0005618 | Cellular Component | 1.76158e-15 | 95% |
| Blast2go | vacuolar membrane | GO:0005774 | Cellular Component | 1.76158e-15 | 95% |
| Blast2go | cytosol | GO:0005829 | Cellular Component | 1.76158e-15 | 95% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aspartate/other aminotransferase | IPR000796 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PSV4
Fln msg: Separated hits, possible frame ERROR between 114 and 119, STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 76 - 462
Fln protein:
T
Protein Length:
77
Fln nts:
A
Fln Alignment:
AllPineV4_rep_c108430___GTPGDWSHILRELGxxTFTGLNKDQVAFMTAEYHIYLTSDGRISMAGLSSKT
C0PSV4_______________GTPGDWSHIIKQIGxxTFTGLNKDQVSFMTAEYHIYLTSDGRISMAGLSSKT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
