UniGene Name: sp_v2.0_unigene74483
Length: 206 nt
Origin of reads:
UniGene Fasta |
---|
>sp_v2.0_unigene74483
A |
Ace file of the UniGene sp_v2.0_unigene74483 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | wall-associated kinase 4-like [Oryza sativa Japonica Group] dbj|BAG94677.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 3.0e-15 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Blast2go | kinase-like protein | - | - | 7.15126e-23 | 77% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ93
Fln msg: Distance to subject end: 148 aas, your sequence is shorter than subject: 68 - 350
Fln protein:
K
Protein Length:
69
Fln nts:
A
Fln Alignment:
AllPineV4_rep_c107565___LPWNTRFNIAVQTAQALAFLHS-IHPHILHRDVKSSNILLGDNFIAKVADFGLCRLVPVDASHVTT
B8LQ93_______________LDWSRRMNIAIGSAEGLAYLHHHATPHIIHRDIKASNVLLDSDFKAQVADFGFAKLIPEGETHVTT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain