UniGene Name: sp_v2.0_unigene67344
Length: 208 nt
Origin of reads:
![]() |
---|
>sp_v2.0_unigene67344
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Fatty acyl-CoA reductase 3 n=2 Tax=Arabidopsis RepID=FACR3_ARATH | - | - | 2.0e-14 | 56% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Blast2go | male sterility protein 2 | - | - | 2.97146e-28 | 75% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Methionine synthase. | EC:2.1.1.13 | - | 2.97146e-28 | 75% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Cysteine and methionine metabolism | 00270 | 2.97146e-28 | 75% | |
Blast2go | Selenocompound metabolism | 00450 | 2.97146e-28 | 75% | |
Blast2go | One carbon pool by folate | 00670 | 2.97146e-28 | 75% | |
Blast2go | Metabolic pathways | 01100 | 2.97146e-28 | 75% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 2.97146e-28 | 75% | |
Blast2go | EC:1.2.1.5- | - | 2.97146e-28 | 75% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | transcription, DNA-dependent | GO:0006351 | Biological Process | 2.97146e-28 | 75% |
Blast2go | response to wounding | GO:0009611 | Biological Process | 2.97146e-28 | 75% |
Blast2go | pollen exine formation | GO:0010584 | Biological Process | 2.97146e-28 | 75% |
Blast2go | suberin biosynthetic process | GO:0010345 | Biological Process | 2.97146e-28 | 75% |
Blast2go | response to salt stress | GO:0009651 | Biological Process | 2.97146e-28 | 75% |
Blast2go | far-red light signaling pathway | GO:0010018 | Biological Process | 2.97146e-28 | 75% |
Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 2.97146e-28 | 75% |
Blast2go | wax biosynthetic process | GO:0010025 | Biological Process | 2.97146e-28 | 75% |
Blast2go | positive regulation of circadian rhythm | GO:0042753 | Biological Process | 2.97146e-28 | 75% |
Blast2go | fatty-acyl-CoA reductase (alcohol-forming) activity | GO:0080019 | Molecular Function | 2.97146e-28 | 75% |
Blast2go | protein binding | GO:0005515 | Molecular Function | 2.97146e-28 | 75% |
Blast2go | methionine synthase activity | GO:0008705 | Molecular Function | 2.97146e-28 | 75% |
Blast2go | long-chain-fatty-acyl-CoA reductase activity | GO:0050062 | Molecular Function | 2.97146e-28 | 75% |
Blast2go | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 2.97146e-28 | 75% |
Blast2go | chloroplast envelope | GO:0009941 | Cellular Component | 2.97146e-28 | 75% |
Blast2go | apoplast | GO:0048046 | Cellular Component | 2.97146e-28 | 75% |
Blast2go | cytosol | GO:0005829 | Cellular Component | 2.97146e-28 | 75% |
Blast2go | endoplasmic reticulum | GO:0005783 | Cellular Component | 2.97146e-28 | 75% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 2.97146e-28 | 75% |
Blast2go | nucleus | GO:0005634 | Cellular Component | 2.97146e-28 | 75% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Male sterility | IPR004262 | - | 0.0 | - |
Sma3 | Male sterility, NAD-binding | IPR013120 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NSE8
Fln msg: Distance to subject end: 165 aas, your sequence is shorter than subject: 69 - 296
Fln protein:
M
Protein Length:
70
Fln nts:
A
Fln Alignment:
AllPineV4_rep_c92109___FDDRYDTSLNVNTNGAKNMVEFAKRCRKLQILLHVSTAYVIGHGKGRIMEKPVKMGETITAGNGAE
A9NSE8_______________FDDRYDISLNVNTRGAENIVEFAKRCRKLQILLHVSTAYVVGRGSGRIKESPLKIGESMTAGNELE
![]() |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
92 | 66 | 33 | 0.997454 | ||
113 | 66 | 33 | 0.997467 | ||
119 | 33 | 66 | 0.997471 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain