UniGene Name: sp_v2.0_unigene63957
Length: 238 nt
Origin of reads:
![]() |
---|
>sp_v2.0_unigene63957
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Aspartate aminotransferase n=8 Tax=Pinaceae RepID=C0PSV4_PICSI | - | - | 6.0e-20 | 96% |
FL-Next | sp=Aspartate aminotransferase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Blast2go | aspartate aminotransferase | - | - | 5.02858e-24 | 92% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Aspartate transaminase. | EC:2.6.1.1 | - | 5.02858e-24 | 92% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | nitrogen compound metabolic process | GO:0006807 | Biological Process | 5.02858e-24 | 92% |
Blast2go | copper ion binding | GO:0005507 | Molecular Function | 5.02858e-24 | 92% |
Blast2go | L-aspartate:2-oxoglutarate aminotransferase activity | GO:0004069 | Molecular Function | 5.02858e-24 | 92% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 5.02858e-24 | 92% |
Blast2go | cell wall | GO:0005618 | Cellular Component | 5.02858e-24 | 92% |
Blast2go | vacuolar membrane | GO:0005774 | Cellular Component | 5.02858e-24 | 92% |
Blast2go | cytosol | GO:0005829 | Cellular Component | 5.02858e-24 | 92% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aspartate/other aminotransferase | IPR000796 | - | 0.0 | - |
Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKC5
Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 70 - 424
Fln protein:
S
Protein Length:
71
Fln nts:
C
Fln Alignment:
AllPineV4_rep_c81232___FTGLNKDQVAFMTAEYHIYLTSDGRISMAGLSSKTVPHLADAIHAAVLRRG
B8LKC5_______________FTGLNKDQVSFMTAEYHIYLTSDGRISMAGLSSKTVPHLADAIHAAVLRLG
![]() |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
27 | 33 | 66 | 0.997471 | ||
29 | 66 | 33 | 0.997471 | ||
30 | 33 | 66 | 0.997471 | ||
32 | 66 | 33 | 0.997476 | ||
35 | 66 | 33 | 0.997476 | ||
36 | 33 | 66 | 0.997471 | ||
50 | 33 | 66 | 0.997471 | ||
63 | 25 | 75 | 0.996483 | ||
65 | 75 | 25 | 0.996481 | ||
67 | 75 | 25 | 0.996481 | ||
71 | 75 | 25 | 0.996477 | ||
73 | 75 | 25 | 0.996478 | ||
74 | 66 | 33 | 0.997452 | ||
75 | 66 | 33 | 0.997452 | ||
77 | 66 | 33 | 0.997452 | ||
79 | 66 | 33 | 0.997452 | ||
80 | 66 | 33 | 0.997452 | ||
81 | 66 | 33 | 0.997452 | ||
82 | 33 | 66 | 0.997452 | ||
83 | 33 | 66 | 0.997452 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain