SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene57365

Length: 371 nt

UniGene Fasta

>sp_v2.0_unigene57365
CGTCGTGACCTTGGCTGTCACTCAGGGTCGTATCTTGGAGTAGTAAGAAACAACCAATTGTTTCTTTATCATCAACCGAATCAGAGTACAAAGCTTTGACCAATGCCACCTGTGAAGCTATTTGGTTGCAGAGAGTCCTTGCAGATCTTGAAGAAGTGCAAAGTGGTTCAACATGTATCAATTGTGATAATCAGAGTGCTATCAAGTTAGCACATAATCCAGTTTACCATGCTAGAACAAAACATGTTGAGTTACAGTACCACTTTGTACGTGAGAAAATTGAGTCAAATGAAATCGGATTGATATTTTGTAACACCAAGGATAATGTGGCTGATATATTTACTAAGCCCCTTGGTAAAATCAAATTTGAA

Ace file of the UniGene sp_v2.0_unigene57365

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Unassigned protein	-	-	0.0	-
FL-Next	tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	42%
Blast2go	copia-type polyprotein	-	-	1.41969e-34	70%

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	BTB/POZ-like	IPR000210	-	-
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Glycoside hydrolase, family 38, core	IPR000602	-	-
Sma3	RNA helicase, ATP-dependent, DEAD-box, conserved site	IPR000629	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Cytochrome P450	IPR001128	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	tRNA-dihydrouridine synthase	IPR001269	-	-
Sma3	Importin-beta, N-terminal	IPR001494	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	Phosphotransferase system, HPr serine phosphorylation site	IPR002114	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Cytochrome P450, E-class, group I	IPR002401	-	-
Sma3	Lipase, class 3	IPR002921	-	-
Sma3	Argonaute/Dicer protein, PAZ	IPR003100	-	-
Sma3	Stem cell self-renewal protein Piwi	IPR003165	-	-
Sma3	HhH-GPD domain	IPR003265	-	-
Sma3	Chloroplast envelope membrane protein, CemA	IPR004282	-	-
Sma3	Oxoglutarate/iron-dependent oxygenase	IPR005123	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Transcription factor GRAS	IPR005202	-	-
Sma3		IPR010256	-	-
Sma3	BTB/POZ fold	IPR011333	-	-
Sma3	Glycosyl hydrolases 38, C-terminal	IPR011682	-	-
Sma3	Armadillo-like helical	IPR011989	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	BTB/POZ	IPR013069	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Exportin-1/Importin-beta-like	IPR013598	-	-
Sma3	Aldolase-type TIM barrel	IPR013785	-	-
Sma3	Domain of unknown function DUF1785	IPR014811	-	-
Sma3	CRM1 C-terminal domain	IPR014877	-	-
Sma3	Glycoside hydrolase, family 38, central domain	IPR015341	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3		IPR017973	-	-
Sma3	Superoxide dismutase, copper/zinc, binding site	IPR018152	-	-
Sma3	tRNA-dihydrouridine synthase, conserved site	IPR018517	-	-

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: Q9M5J7

Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 39 aas, your sequence is shorter than subject: 123 - 542

Fln protein: S*PWLSLRVVSWSSKKQPIVSLSSTESEYKALTNATCEAIWLQRVLADLEEVQSGSTCINCDNQSAIKLAHNPVYHARTKHVELQYHFVREKIESNEIGLIFCNTKDNVADIFTKPLGKIKFE

Protein Length: 124

Fln nts: CGTCGTGACCTTGGCTGTCACTCAGGGTCGTATCTTGGAGTAGTAAGAAACAACCAATTGTTTCTTTATCATCAACCGAATCAGAGTACAAAGCTTTGACCAATGCCACCTGTGAAGCTATTTGGTTGCAGAGAGTCCTTGCAGATCTTGAAGAAGTGCAAAGTGGTTCAACATGTATCAATTGTGATAATCAGAGTGCTATCAAGTTAGCACATAATCCAGTTTACCATGCTAGAACAAAACATGTTGAGTTACAGTACCACTTTGTACGTGAGAAAATTGAGTCAAATGAAATCGGATTGATATTTTGTAACACCAAGGATAATGTGGCTGATATATTTACTAAGCCCCTTGGTAAAATCAAATTTGAA

Fln Alignment:

AllPineV4_c57716___VSWSSKKQPIVSLSSTESEYKALTNATCEAIWLQRVLADLEEVQSGSTCINCDNQSAIKLAHNPVYHARTKHVEL
Q9M5J7_______________ISWMSKIQALVALSTTEAEYMVATHASQGSIWLQRLCSGIGLVQQ-VVRLDCEIQSAIFMAKNPAYDSKTNHIDV

SNPs (tot: 5)

Position	A %	C %	G %	T %	Probability
200	33			66	0.997452
203		66	33		0.997452
204	66			33	0.997452
273			66	33	0.997457
275		33	66		0.997461

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain