UniGene Name: sp_v2.0_unigene57257
Length: 217 nt
![]() |
---|
>sp_v2.0_unigene57257
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative receptor-like protein kinase 2 [Oryza sativa Japonica Group] | - | - | 9.0e-21 | 74% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
Blast2go | probable leucine-rich repeat receptor-like protein kinase at5g49770-like | - | - | 7.07806e-26 | 94% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | cell part | GO:0044464 | Cellular Component | 7.07806e-26 | 94% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9B2
Fln msg: Distance to subject end: 68 aas, your sequence is shorter than subject: 71 - 338
Fln protein:
C
Protein Length:
72
Fln nts:
A
Fln Alignment:
AllPineV4_c57584___GHAGHVSTQVKGTMGYLDPEYYMTQQLTQKSDVYSFGVVLLEILASRQPLVERGKYLVQEVKTAM
D5A9B2_______________GDSQVISTQIAGTLGYLDPEYLSTGQLSLNSDVYSFGVLLLELITARPAREATGGLLVTVVKTSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain