|
||||||
|
UniGene Name: sp_v2.0_unigene55982
Length: 246 nt
 UniGene Fasta
|
|---|
| >sp_v2.0_unigene55982
G |
|
Ace file of the UniGene sp_v2.0_unigene55982
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Myosin XI, putative n=1 Tax=Ricinus communis RepID=B9S596_RICCO | - | - | 6.0e-35 | 91% |
| FL-Next | tr=Myosin XI, putative; Ricinus communis (Castor bean). | - | - | 0.0 | 91% |
| Blast2go | myosin 2 | - | - | 4.5772e-41 | 95% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | root hair elongation | GO:0048767 | Biological Process | 4.5772e-41 | 95% |
| Blast2go | peroxisome localization | GO:0060151 | Biological Process | 4.5772e-41 | 95% |
| Blast2go | mitochondrion localization | GO:0051646 | Biological Process | 4.5772e-41 | 95% |
| Blast2go | Golgi localization | GO:0051645 | Biological Process | 4.5772e-41 | 95% |
| Blast2go | Rab GTPase binding | GO:0017137 | Molecular Function | 4.5772e-41 | 95% |
| Blast2go | GTP-dependent protein binding | GO:0030742 | Molecular Function | 4.5772e-41 | 95% |
| Blast2go | peroxisome | GO:0005777 | Cellular Component | 4.5772e-41 | 95% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9S596
Fln msg: Distance to subject end: 1132 aas, your sequence is shorter than subject: 82 - 1350
Fln protein:
A
Protein Length:
83
Fln nts:
G
Fln Alignment:
AllPineV4_c56039___AVADAAYRVMINDGISQAILVSGESGAGKTESTKMLMRYLAYMGGRGVTEGRSVEQQVLESNPVLEAFGNAKTVRNNNSSRF
B9S596_______________AVADAAYRLMINEGISQSILVSGESGAGKTESTKLLMRYLAYMGGRAVAEGRTVEQQVLESNPVLEAFGNAKTVRNNNSSRF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
