UniGene Name: sp_v2.0_unigene54915
Length: 228 nt
Origin of reads:
UniGene Fasta |
---|
>sp_v2.0_unigene54915
A |
Ace file of the UniGene sp_v2.0_unigene54915 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Cycas revoluta RepID=Q4JQ46_CYCRE | - | - | 6.0e-23 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Blast2go | reverse transcriptase | - | - | 3.67401e-30 | 82% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 199 aas, your sequence is shorter than subject: 76 - 363
Fln protein:
I
Protein Length:
77
Fln nts:
A
Fln Alignment:
AllPineV4_c54758___IHQMDVKSAFLNGDLKEEVYLVQPEGFVKHGQEHLVCRLRKALYGLKQAPRSWYVKIDTFFLQNGFVKSKNEPT
B8LKV8_______________VYQMDVKSAFLNGYLEEEVYVQQPPRYEVRGQEDKVYRLKKALNGLKQAPRAWYSKIDSYMIKNEFIRSTSEPT
SNPs (tot: 3) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
105 | 66 | 33 | 0.997454 | ||
120 | 66 | 33 | 0.997476 | ||
147 | 33 | 66 | 0.997467 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain