|
||||||
|
UniGene Name: sp_v2.0_unigene52711
Length: 234 nt
Origin of reads:
 UniGene Fasta
|
|---|
| >sp_v2.0_unigene52711
A |
|
Ace file of the UniGene sp_v2.0_unigene52711
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | F5J5.14 n=1 Tax=Arabidopsis thaliana RepID=Q9SKV6_ARATH | - | - | 9.0e-21 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
| Blast2go | retroelement pol polyprotein | - | - | 1.08866e-24 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 253 aas, your sequence is shorter than subject: 77 - 363
Fln protein:
I
Protein Length:
78
Fln nts:
A
Fln Alignment:
AllPineV4_c52147___KHGADGSVEKFKARFVAQGFSQK*GVDYDEIFAPVARYTTIHSIIALAASQGWKLQQMDVKTAFLHGSIKEEVYVE
B8LKV8_______________KYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNGYLEEEVYVQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
