UniGene Name: sp_v2.0_unigene50688
Length: 237 nt
Origin of reads:
![]() |
---|
>sp_v2.0_unigene50688
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Calreticulin n=1 Tax=Polysphondylium pallidum RepID=D3BIF1_POLPA | - | - | 1.0e-28 | 74% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Blast2go | calreticulin precursor | - | - | 3.30653e-35 | 84% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | negative regulation of translation | GO:0017148 | Biological Process | 3.30653e-35 | 84% |
Blast2go | cardiac muscle cell differentiation | GO:0055007 | Biological Process | 3.30653e-35 | 84% |
Blast2go | spermatogenesis | GO:0007283 | Biological Process | 3.30653e-35 | 84% |
Blast2go | response to testosterone stimulus | GO:0033574 | Biological Process | 3.30653e-35 | 84% |
Blast2go | cellular response to organic substance | GO:0071310 | Biological Process | 3.30653e-35 | 84% |
Blast2go | cellular response to lithium ion | GO:0071285 | Biological Process | 3.30653e-35 | 84% |
Blast2go | response to drug | GO:0042493 | Biological Process | 3.30653e-35 | 84% |
Blast2go | regulation of meiosis | GO:0040020 | Biological Process | 3.30653e-35 | 84% |
Blast2go | cortical actin cytoskeleton organization | GO:0030866 | Biological Process | 3.30653e-35 | 84% |
Blast2go | response to estradiol stimulus | GO:0032355 | Biological Process | 3.30653e-35 | 84% |
Blast2go | protein binding | GO:0005515 | Molecular Function | 3.30653e-35 | 84% |
Blast2go | calcium ion binding | GO:0005509 | Molecular Function | 3.30653e-35 | 84% |
Blast2go | hormone binding | GO:0042562 | Molecular Function | 3.30653e-35 | 84% |
Blast2go | iron ion binding | GO:0005506 | Molecular Function | 3.30653e-35 | 84% |
Blast2go | peptide binding | GO:0042277 | Molecular Function | 3.30653e-35 | 84% |
Blast2go | mRNA binding | GO:0003729 | Molecular Function | 3.30653e-35 | 84% |
Blast2go | acrosomal vesicle | GO:0001669 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | sarcoplasmic reticulum | GO:0016529 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | microsome | GO:0005792 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | extracellular space | GO:0005615 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | Golgi apparatus | GO:0005794 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | external side of plasma membrane | GO:0009897 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | perinuclear region of cytoplasm | GO:0048471 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | soluble fraction | GO:0005625 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | nucleus | GO:0005634 | Cellular Component | 3.30653e-35 | 84% |
Blast2go | extracellular matrix | GO:0031012 | Cellular Component | 3.30653e-35 | 84% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Calreticulin/calnexin | IPR001580 | - | 0.0 | - |
Sma3 | Ribosomal protein L38e | IPR002675 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Calreticulin/calnexin, P | IPR009033 | - | 0.0 | - |
Sma3 | Calreticulin | IPR009169 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | Calreticulin/calnexin, conserved site | IPR018124 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUL6
Fln msg: Distance to subject end: 250 aas, your sequence is shorter than subject: 78 - 418
Fln protein:
S
Protein Length:
79
Fln nts:
C
Fln Alignment:
AllPineV4_c49744___SNEGKDLIVQYSVKHEQRIDCGGAYIKLLPSGLDQEKFNGDSTYNIMFGPDICGSSTRKTHLIFTYKGKNHLIKKDI
A9NUL6_______________SNKDKTLVLQFSVKHEQKLDCGGGYVKLLSGEIDQKNFTGETPYSIMFGPDICGYSTKKVHVILSNKGQNHPIKKDV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain