UniGene Name: sp_v2.0_unigene49534
Length: 244 nt
![]() |
---|
>sp_v2.0_unigene49534
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Molybdenum cofactor sulfurase; Short=MOS; Short=MoCo sulfurase gb|AAL71858.1| molybdenum cofactor sulfurase [Solanum lycopersicum] | - | - | 6.0e-18 | 84% |
FL-Next | sp=Molybdenum cofactor sulfurase; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 89% |
Blast2go | molybdenum cofactor sulfurase | - | - | 1.73106e-19 | 89% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Selenocysteine lyase. | EC:4.4.1.16 | - | 1.73106e-19 | 89% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Selenocompound metabolism | 00450 | 1.73106e-19 | 89% | |
Blast2go | Metabolic pathways | 01100 | 1.73106e-19 | 89% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | abscisic acid biosynthetic process | GO:0009688 | Biological Process | 1.73106e-19 | 89% |
Blast2go | auxin mediated signaling pathway | GO:0009734 | Biological Process | 1.73106e-19 | 89% |
Blast2go | response to salt stress | GO:0009651 | Biological Process | 1.73106e-19 | 89% |
Blast2go | stomatal movement | GO:0010118 | Biological Process | 1.73106e-19 | 89% |
Blast2go | defense response to bacterium | GO:0042742 | Biological Process | 1.73106e-19 | 89% |
Blast2go | Mo-molybdopterin cofactor metabolic process | GO:0019720 | Biological Process | 1.73106e-19 | 89% |
Blast2go | response to cold | GO:0009409 | Biological Process | 1.73106e-19 | 89% |
Blast2go | response to heat | GO:0009408 | Biological Process | 1.73106e-19 | 89% |
Blast2go | protein import into chloroplast stroma | GO:0045037 | Biological Process | 1.73106e-19 | 89% |
Blast2go | molybdenum incorporation into molybdenum-molybdopterin complex | GO:0018315 | Biological Process | 1.73106e-19 | 89% |
Blast2go | selenocysteine lyase activity | GO:0009000 | Molecular Function | 1.73106e-19 | 89% |
Blast2go | Mo-molybdopterin cofactor sulfurase activity | GO:0008265 | Molecular Function | 1.73106e-19 | 89% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
Sma3 | Molybdenum cofactor sulfurase, C-terminal | IPR005302 | - | 0.0 | - |
Sma3 | MOSC, N-terminal beta barrel | IPR005303 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
Sma3 | IPR015467 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q655R6
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 677 aas, your sequence is shorter than subject: 81 - 824
Fln protein:
I
Protein Length:
82
Fln nts:
T
Fln Alignment:
AllPineV4_c48351___YKCIFTSGATAALKLVGETFPWSTDSIYTYTMENHNSVLGIREYAL
Q655R6_______________YKCIFTSGATAALKLVGECFPWSRESCYMYTMENHNSVLGIREYAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain