UniGene Name: sp_v2.0_unigene47368
Length: 245 nt
![]() |
---|
>sp_v2.0_unigene47368
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP binding/protein serine/threonine kinase n=4 Tax=Magnoliophyta RepID=C6FF68_SOYBN | - | - | 7.0e-39 | 95% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
Blast2go | at1g55610-like protein | - | - | 0.0 | 97% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | phloem transport | GO:0010233 | Biological Process | 0.0 | 97% |
Blast2go | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | 97% |
Blast2go | metabolic process | GO:0008152 | Biological Process | 0.0 | 97% |
Blast2go | brassinosteroid mediated signaling pathway | GO:0009742 | Biological Process | 0.0 | 97% |
Blast2go | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | 97% |
Blast2go | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | 97% |
Blast2go | identical protein binding | GO:0042802 | Molecular Function | 0.0 | 97% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Intradiol ring-cleavage dioxygenase, C-terminal | IPR000627 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Interleukin-4/interleukin-13, conserved site | IPR018096 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LM41
Fln msg: Distance to subject end: 224 aas, your sequence is shorter than subject: 81 - 613
Fln protein:
G
Protein Length:
82
Fln nts:
G
Fln Alignment:
AllPineV4_c45850___GCGGFGEVFKATLKDGSNVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKVGEERLLVYEYMQFGSLEDML
B8LM41_______________GSGRTGTVYRATLTDGSVMAIKRL-RDSAQSEKQFKAEMNTLARLRHRNLVPLLGYCIAGQEKLLVYKHMANGSLWDCL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain