UniGene Name: sp_v2.0_unigene47216
Length: 236 nt
Origin of reads:
![]() |
---|
>sp_v2.0_unigene47216
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RB88_RICCO | - | - | 2.0e-11 | 48% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 40% |
Blast2go | atp binding | - | - | 7.37884e-14 | 63% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Cinnamoyl-CoA reductase. | EC:1.2.1.44 | - | 7.37884e-14 | 63% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Phenylpropanoid biosynthesis | 00940 | 7.37884e-14 | 63% | |
Blast2go | Biosynthesis of phenylpropanoids | 01061 | 7.37884e-14 | 63% | |
Blast2go | Metabolic pathways | 01100 | 7.37884e-14 | 63% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 7.37884e-14 | 63% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | DNA duplex unwinding | GO:0032508 | Biological Process | 7.37884e-14 | 63% |
Blast2go | carotenoid biosynthetic process | GO:0016117 | Biological Process | 7.37884e-14 | 63% |
Blast2go | regulation of stomatal movement | GO:0010119 | Biological Process | 7.37884e-14 | 63% |
Blast2go | etioplast organization | GO:0009662 | Biological Process | 7.37884e-14 | 63% |
Blast2go | mRNA export from nucleus | GO:0006406 | Biological Process | 7.37884e-14 | 63% |
Blast2go | response to salt stress | GO:0009651 | Biological Process | 7.37884e-14 | 63% |
Blast2go | response to zinc ion | GO:0010043 | Biological Process | 7.37884e-14 | 63% |
Blast2go | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 7.37884e-14 | 63% |
Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 7.37884e-14 | 63% |
Blast2go | response to cold | GO:0009409 | Biological Process | 7.37884e-14 | 63% |
Blast2go | innate immune response | GO:0045087 | Biological Process | 7.37884e-14 | 63% |
Blast2go | RNA secondary structure unwinding | GO:0010501 | Biological Process | 7.37884e-14 | 63% |
Blast2go | circadian rhythm | GO:0007623 | Biological Process | 7.37884e-14 | 63% |
Blast2go | protein kinase activity | GO:0004672 | Molecular Function | 7.37884e-14 | 63% |
Blast2go | single-stranded DNA binding | GO:0003697 | Molecular Function | 7.37884e-14 | 63% |
Blast2go | cinnamoyl-CoA reductase activity | GO:0016621 | Molecular Function | 7.37884e-14 | 63% |
Blast2go | carotenoid isomerase activity | GO:0046608 | Molecular Function | 7.37884e-14 | 63% |
Blast2go | RNA binding | GO:0003723 | Molecular Function | 7.37884e-14 | 63% |
Blast2go | double-stranded DNA binding | GO:0003690 | Molecular Function | 7.37884e-14 | 63% |
Blast2go | protein homodimerization activity | GO:0042803 | Molecular Function | 7.37884e-14 | 63% |
Blast2go | chloroplast | GO:0009507 | Cellular Component | 7.37884e-14 | 63% |
Blast2go | peroxisome | GO:0005777 | Cellular Component | 7.37884e-14 | 63% |
Blast2go | nucleus | GO:0005634 | Cellular Component | 7.37884e-14 | 63% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRZ4
Fln msg: Distance to subject end: 215 aas, your sequence is shorter than subject: 78 - 511
Fln protein:
Y
Protein Length:
79
Fln nts:
T
Fln Alignment:
AllPineV4_c45671___SDIYSFGVVLLEILSGRPCFGGDSGEPRSITEWAVPLITNSRAPEIFDPKLQLPVNPDPLIRAAKLACGCV
B8LRZ4_______________NDVFSFGILLLEIISGRNAIDVQYSPP-SIVDWAMPLIRQNKILELYDPRLSPPKNLNTIKHMALIAARCV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain