SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v2.0

UniGene Name: sp_v2.0_unigene43037

Length: 272 nt

Origin of reads: Uma v2

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v2.0_unigene43037
AGCCTTCTATTACGCCGCGAGTGTTGCTCATTTAGCAATGGGGAGTATGTTAAGGCAGGGTTGGCAGAACTGGAACGTTGGTGCCATGAAGCAACAGCAGAGTATGCAGGGTCAGCATGGGATGAACTCACACATATCCGGCAAGCTGTGGGATTTCTGGTTATACAAAAAAAGTCCCAGAAGTCCGTGGAAGAAATTATCAATGACCTTTGCCGGTTTTGAGCATACAACAAATATATCGTATCAGTACCATGTTCTGGGATGATAAATAT

Ace file of the UniGene sp_v2.0_unigene43037 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Myosin family protein with Dil domain [Arabidopsis thaliana] gb\|AED92851.1\| Myosin family protein with Dil domain [Arabidopsis thaliana]	-	-	1.0e-33	80%
FL-Next	tr=Predicted protein; subsp. trichocarpa).	-	-	0.0	81%
Blast2go	myosin-h heavy chain-like	-	-	7.96156e-35	90%

Source	GOs	Term	Type	e value	Identity
Blast2go	root hair cell tip growth	GO:0048768	Biological Process	7.96156e-35	90%
Blast2go	peroxisome localization	GO:0060151	Biological Process	7.96156e-35	90%
Blast2go	fruit development	GO:0010154	Biological Process	7.96156e-35	90%
Blast2go	cell division	GO:0051301	Biological Process	7.96156e-35	90%
Blast2go	post-embryonic development	GO:0009791	Biological Process	7.96156e-35	90%
Blast2go	mitochondrion localization	GO:0051646	Biological Process	7.96156e-35	90%
Blast2go	trichome branching	GO:0010091	Biological Process	7.96156e-35	90%
Blast2go	Golgi localization	GO:0051645	Biological Process	7.96156e-35	90%
Blast2go	cell part	GO:0044464	Cellular Component	7.96156e-35	90%

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	Ribosomal protein S7	IPR000235	-	-
Sma3	Involucrin repeat	IPR000354	-	-
Sma3	DNA topoisomerase, type IA	IPR000380	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site	IPR001216	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	Pyridoxal phosphate-dependent enzyme, beta subunit	IPR001926	-	-
Sma3	Dilute	IPR002710	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	No apical meristem (NAM) protein	IPR003441	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	DNA topoisomerase, type IA, domain 2	IPR003601	-	-
Sma3	HAMP linker domain	IPR003660	-	-
Sma3	Myosin, N-terminal, SH3-like	IPR004009	-	-
Sma3	Cysteine synthase K/M	IPR005856	-	-
Sma3	Cysteine synthase A	IPR005859	-	-
Sma3		IPR006154	-	-
Sma3	Toprim domain	IPR006171	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	DNA topoisomerase, type IA, central	IPR013497	-	-
Sma3	DNA topoisomerase, type IA, central region, subdomain 3	IPR013826	-	-
Sma3	Beta tubulin, autoregulation binding site	IPR013838	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	Dil domain	IPR018444	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: B9N1A3

Fln msg: Overlapping hits, possible frame ERROR between 213 and 213, Distance to subject end: 76 aas, your sequence is shorter than subject: 91 - 1462

Fln protein: SLLLRRECCSFSNGEYVKAGLAELERWCHEATAEYAGSAWDELTHIRQAVGFLVIQKKSQKSVEEIINDLxxVLSIQQIYRISTMFWDDKY

Protein Length: 92

Fln nts: AGCCTTCTATTACGCCGCGAGTGTTGCTCATTTAGCAATGGGGAGTATGTTAAGGCAGGGTTGGCAGAACTGGAACGTTGGTGCCATGAAGCAACAGCAGAGTATGCAGGGTCAGCATGGGATGAACTCACACATATCCGGCAAGCTGTGGGATTTCTGGTTATACAAAAAAAGTCCCAGAAGTCCGTGGAAGAAATTATCAATGACCTTxxxxxxGTTTTGAGCATACAACAAATATATCGTATCAGTACCATGTTCTGGGATGATAAATAT

Fln Alignment:

AllPineV4_c40686___SLLLRRECCSFSNGEYVKAGLAELERWCHEATAEYAGSAWDELTHIRQAVGFLVIQKKSQKSVEEIINDLCPVLSIQQIYRISTMFWDDKY
B9N1A3_______________SLLLRRECCSFSNGEYVKAGLAELEQWCHDATEEFAGSAWDELKHIRQAVGFLVIHQKPKKTLKEITNDLCPVLSIQQLYRISTMYWDDKY

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain