UniGene Name: inia_v1.0_unigene6205
Length: 224 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>inia_v1.0_unigene6205
T |
Ace file of the UniGene inia_v1.0_unigene6205 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene6918 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [Arabidopsis thaliana] sp|Q9ZPI5.1|MFP2_ARATH RecName: Full=Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2; Short=AtMPF2; Includes: RecName: Full=Enoyl-CoA hydratase/3-2-trans-enoyl-C | - | - | 0.0 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Blast2go | glyoxysomal fatty acid beta-oxidation multifunctional protein mfp-a | - | - | 0.0 | 85% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Long-chain-enoyl-CoA hydratase. | EC:4.2.1.74 | - | 0.0 | 85% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Fatty acid elongation in mitochondria | 00062 | 0.0 | 85% | |
Blast2go | Fatty acid metabolism | 00071 | 0.0 | 85% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 85% | |
Blast2go | 3-hydroxybutyryl-CoA epimerase. | EC:5.1.2.3 | - | 0.0 | 85% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Fatty acid metabolism | 00071 | 0.0 | 85% | |
Blast2go | Butanoate metabolism | 00650 | 0.0 | 85% | |
Blast2go | Dodecenoyl-CoA isomerase. | EC:5.3.3.8 | - | 0.0 | 85% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Fatty acid metabolism | 00071 | 0.0 | 85% | |
Blast2go | 3-hydroxyacyl-CoA dehydrogenase. | EC:1.1.1.35 | - | 0.0 | 85% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Fatty acid elongation in mitochondria | 00062 | 0.0 | 85% | |
Blast2go | Fatty acid metabolism | 00071 | 0.0 | 85% | |
Blast2go | Primary bile acid biosynthesis | 00120 | 0.0 | 85% | |
Blast2go | Valine, leucine and isoleucine degradation | 00280 | 0.0 | 85% | |
Blast2go | Geraniol degradation | 00281 | 0.0 | 85% | |
Blast2go | Lysine degradation | 00310 | 0.0 | 85% | |
Blast2go | Tryptophan metabolism | 00380 | 0.0 | 85% | |
Blast2go | Toluene degradation | 00623 | 0.0 | 85% | |
Blast2go | Butanoate metabolism | 00650 | 0.0 | 85% | |
Blast2go | Carbon fixation pathways in prokaryotes | 00720 | 0.0 | 85% | |
Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 85% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 85% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 85% | |
Blast2go | Enoyl-CoA hydratase. | EC:4.2.1.17 | - | 0.0 | 85% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Fatty acid elongation in mitochondria | 00062 | 0.0 | 85% | |
Blast2go | Fatty acid metabolism | 00071 | 0.0 | 85% | |
Blast2go | Valine, leucine and isoleucine degradation | 00280 | 0.0 | 85% | |
Blast2go | Geraniol degradation | 00281 | 0.0 | 85% | |
Blast2go | Lysine degradation | 00310 | 0.0 | 85% | |
Blast2go | Benzoate degradation | 00362 | 0.0 | 85% | |
Blast2go | Tryptophan metabolism | 00380 | 0.0 | 85% | |
Blast2go | beta-Alanine metabolism | 00410 | 0.0 | 85% | |
Blast2go | alpha-Linolenic acid metabolism | 00592 | 0.0 | 85% | |
Blast2go | Aminobenzoate degradation | 00627 | 0.0 | 85% | |
Blast2go | Propanoate metabolism | 00640 | 0.0 | 85% | |
Blast2go | Butanoate metabolism | 00650 | 0.0 | 85% | |
Blast2go | Limonene and pinene degradation | 00903 | 0.0 | 85% | |
Blast2go | Biosynthesis of unsaturated fatty acids | 01040 | 0.0 | 85% | |
Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 85% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 85% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 85% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | 85% |
Blast2go | long-chain-enoyl-CoA hydratase activity | GO:0016508 | Molecular Function | 0.0 | 85% |
Blast2go | 3-hydroxybutyryl-CoA epimerase activity | GO:0008692 | Molecular Function | 0.0 | 85% |
Blast2go | dodecenoyl-CoA delta-isomerase activity | GO:0004165 | Molecular Function | 0.0 | 85% |
Blast2go | 3-hydroxyacyl-CoA dehydrogenase activity | GO:0003857 | Molecular Function | 0.0 | 85% |
Blast2go | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | 85% |
Blast2go | enoyl-CoA hydratase activity | GO:0004300 | Molecular Function | 0.0 | 85% |
Blast2go | 3-hydroxyacyl-CoA dehydratase activity | GO:0018812 | Molecular Function | 0.0 | 85% |
Blast2go | cell wall | GO:0005618 | Cellular Component | 0.0 | 85% |
Blast2go | nucleolus | GO:0005730 | Cellular Component | 0.0 | 85% |
Blast2go | glyoxysome | GO:0009514 | Cellular Component | 0.0 | 85% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 3-hydroxyacyl-CoA dehydrogenase, NAD binding | IPR006176 | - | 0.0 | - |
Sma3 | 3-hydroxyacyl-CoA dehydrogenase, C-terminal | IPR006108 | - | 0.0 | - |
Sma3 | Crotonase, core | IPR001753 | - | 0.0 | - |
Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV15
Fln msg: Distance to subject end: 260 aas, your sequence is shorter than subject: 74 - 726
Fln protein:
V
Protein Length:
75
Fln nts:
T
Fln Alignment:
mc_mira_c6280___VDMVIEAVIENVALKQQIFSDLEKHCPSHCVLATNTSTLDLNLIGQKTNSQDRIVGAHFFSPAHIMPLLEIVRT
A9NV15________________VDIVIEAVIENVALKQQIFSDLEKFCPPHCVLATNTSTIDLSLIGQKTNSQDRIVGAHFFSPAHIMPLLEIVRT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain