UniGene Name: uagpf_v2_unigene55960
Length: 243 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>uagpf_v2_unigene55960
T |
Ace file of the UniGene uagpf_v2_unigene55960 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene83695 | 1/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase n=1 Tax=Picea glauca RepID=Q9M5J7_PICGL | - | - | 0.0 | 53% |
FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 70% |
Blast2go | retrotransposon ty1-copia subclass | - | - | 0.0 | 73% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 305 aas, your sequence is shorter than subject: 69 - 542
Fln protein:
L
Protein Length:
70
Fln nts:
T
Fln Alignment:
uagpf_mira_rep_c93601___VAKVASIRLLLYVTTAFDFEVEQMDVKTKFLHGDLEEEIYMKQHEGFAVKVKKELVCNLKKSLYGLK*SRRI
Q9M5J7________________VAKLTSIRFLLSIVVAFDLEVEQMDVKTTFLHGDLEEEIYMKQPEGFVVKGNKELVCKINKSLCGVKQSPRM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain