|
||||||
|
UniGene Name: uagpf_v2_unigene55084
Length: 232 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene55084
C |
|
Ace file of the UniGene uagpf_v2_unigene55084
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene2568 | 2/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Predicted protein; subsp. trichocarpa). | - | - | 0.0 | 82% |
| Blast2go | protein | - | - | 0.0 | 77% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Aldehyde dehydrogenase (NAD(P)(+)). | EC:1.2.1.5 | - | 0.0 | 77% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycolysis / Gluconeogenesis | 00010 | 0.0 | 77% | |
| Blast2go | Histidine metabolism | 00340 | 0.0 | 77% | |
| Blast2go | Tyrosine metabolism | 00350 | 0.0 | 77% | |
| Blast2go | Phenylalanine metabolism | 00360 | 0.0 | 77% | |
| Blast2go | beta-Alanine metabolism | 00410 | 0.0 | 77% | |
| Blast2go | Metabolism of xenobiotics by cytochrome P450 | 00980 | 0.0 | 77% | |
| Blast2go | Drug metabolism - cytochrome P450 | 00982 | 0.0 | 77% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 77% | |
| Blast2go | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 0.0 | 77% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycolysis / Gluconeogenesis | 00010 | 0.0 | 77% | |
| Blast2go | Pentose and glucuronate interconversions | 00040 | 0.0 | 77% | |
| Blast2go | Ascorbate and aldarate metabolism | 00053 | 0.0 | 77% | |
| Blast2go | Fatty acid metabolism | 00071 | 0.0 | 77% | |
| Blast2go | Valine, leucine and isoleucine degradation | 00280 | 0.0 | 77% | |
| Blast2go | Lysine degradation | 00310 | 0.0 | 77% | |
| Blast2go | Arginine and proline metabolism | 00330 | 0.0 | 77% | |
| Blast2go | Histidine metabolism | 00340 | 0.0 | 77% | |
| Blast2go | Tryptophan metabolism | 00380 | 0.0 | 77% | |
| Blast2go | beta-Alanine metabolism | 00410 | 0.0 | 77% | |
| Blast2go | Glycerolipid metabolism | 00561 | 0.0 | 77% | |
| Blast2go | Pyruvate metabolism | 00620 | 0.0 | 77% | |
| Blast2go | Chloroalkane and chloroalkene degradation | 00625 | 0.0 | 77% | |
| Blast2go | Propanoate metabolism | 00640 | 0.0 | 77% | |
| Blast2go | Limonene and pinene degradation | 00903 | 0.0 | 77% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 77% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 77% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | cell-matrix adhesion | GO:0007160 | Biological Process | 0.0 | 77% |
| Blast2go | cellular aldehyde metabolic process | GO:0006081 | Biological Process | 0.0 | 77% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 77% |
| Blast2go | aldehyde dehydrogenase [NAD(P)+] activity | GO:0004030 | Molecular Function | 0.0 | 77% |
| Blast2go | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | 77% |
| Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 77% |
| Blast2go | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | 77% |
| Blast2go | integrin complex | GO:0008305 | Cellular Component | 0.0 | 77% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde dehydrogenase NAD(P)-dependent | IPR012394 | - | 0.0 | - |
| Sma3 | FG-GAP | IPR013517 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9MXK2
Fln msg: Overlapping hits, possible frame ERROR between 159 and 156, Distance to subject end: 249 aas, your sequence is shorter than subject: 77 - 693
Fln protein:
R
Protein Length:
78
Fln nts:
C
Fln Alignment:
uagpf_mira_c89476___YVPIITNYTQLWWMPNVIVAHQKEGIEAIHLATGRLVCKLHLQExCLHADINGDGVLDHVQAV
B9MXK2________________YIPTITNYTQLWWLPNVVVAHQKEGIEAVHLASGRTLCKLHLQExGLHADINGDGVLDHVQAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
