|
||||||
|
UniGene Name: uagpf_v2_unigene54576
Length: 239 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene54576
C |
|
Ace file of the UniGene uagpf_v2_unigene54576
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene9993 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | tryptophan aminotransferase related 2 [Arabidopsis thaliana] ref|NP_974608.1| tryptophan aminotransferase related 2 [Arabidopsis thaliana] gb|AAK92714.1| putative alliin lyase [Arabidopsis thaliana] gb|AAM14394.1| putative alliin lyase [Arabidopsis thalia | - | - | 0.0 | 56% |
| FL-Next | sp=Tryptophan aminotransferase-related protein 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 47% |
| Blast2go | alliin lyase | - | - | 0.0 | 71% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Tryptophan transaminase. | EC:2.6.1.27 | - | 0.0 | 71% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Tryptophan metabolism | 00380 | 0.0 | 71% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 71% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | gynoecium development | GO:0048467 | Biological Process | 0.0 | 71% |
| Blast2go | indoleacetic acid biosynthetic process | GO:0009684 | Biological Process | 0.0 | 71% |
| Blast2go | positive gravitropism | GO:0009958 | Biological Process | 0.0 | 71% |
| Blast2go | primary root development | GO:0080022 | Biological Process | 0.0 | 71% |
| Blast2go | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | 71% |
| Blast2go | cotyledon development | GO:0048825 | Biological Process | 0.0 | 71% |
| Blast2go | cotyledon vascular tissue pattern formation | GO:0010588 | Biological Process | 0.0 | 71% |
| Blast2go | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | 71% |
| Blast2go | maintenance of root meristem identity | GO:0010078 | Biological Process | 0.0 | 71% |
| Blast2go | binding | GO:0005488 | Molecular Function | 0.0 | 71% |
| Blast2go | L-tryptophan:pyruvate aminotransferase activity | GO:0080097 | Molecular Function | 0.0 | 71% |
| Blast2go | L-tryptophan:2-oxoglutarate aminotransferase activity | GO:0050362 | Molecular Function | 0.0 | 71% |
| Blast2go | carbon-sulfur lyase activity | GO:0016846 | Molecular Function | 0.0 | 71% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
| Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
| Sma3 | EGF-like, alliinase | IPR006947 | - | 0.0 | - |
| Sma3 | Allinase, C-terminal | IPR006948 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
| Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | IPR019782 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q94A02
Fln msg: Distance to subject end: 34 aas, your sequence is shorter than subject: 79 - 440
Fln protein:
R
Protein Length:
80
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c86297___MSERWNSLRDVVTFCRRFILPVFEPRFCNFFGRHTTPRPAFAWLKCEGKEDGDCEKLLK-SNGIITRSGR
Q94A02________________MYERWKLLKQAAKDTKRFSVPDFVSQRCNFFGRVFEPQPAFAWFKCE-EGIVDCEKFLREEKKILTKSGK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
