SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene53632

Length: 248 nt

UniGene Fasta

>uagpf_v2_unigene53632
CGTCGTGACCTTGGCTGTCACGTCGTGACCTTGGCTGTCACTCTATGAGCGAGGATTAATTGGAACTTATCAGGACTGGTGTGAGGCTTTTTCAACATATCCTAGAACTTATGACTTAATTCATGCTGCCGGTGTCTTTAGCATGTATCAGGACAGGTGTGATATAGCTAACATACTTCTTGAGATGGACCGTGTCCTACGCCCTGAAGGGATCGTGATCATTAGGGATGTTGTTGATGTTCTTGGTG

Ace file of the UniGene uagpf_v2_unigene53632

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene7048	4/4

Source	Descriptions	Term	Type	Identity
AutoFact	ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RYZ7_RICCO	-	-	68%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	85%
Blast2go	atp binding	-	-	81%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Transferring one-carbon groups, Methyltransferases.	EC:2.1.1.-	-	0.0	81%

Source	KEGGs	Term	Identity
Blast2go	Ubiquinone and other terpenoid-quinone biosynthesis	00130	81%
Blast2go	Tetracycline biosynthesis	00253	81%
Blast2go	Histidine metabolism	00340	81%
Blast2go	Tyrosine metabolism	00350	81%
Blast2go	Phenylalanine metabolism	00360	81%
Blast2go	Tryptophan metabolism	00380	81%
Blast2go	Benzoxazinoid biosynthesis	00402	81%
Blast2go	Selenocompound metabolism	00450	81%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	81%
Blast2go	Polycyclic aromatic hydrocarbon degradation	00624	81%
Blast2go	Methane metabolism	00680	81%
Blast2go	Porphyrin and chlorophyll metabolism	00860	81%
Blast2go	Carotenoid biosynthesis	00906	81%
Blast2go	Phenylpropanoid biosynthesis	00940	81%
Blast2go	Flavonoid biosynthesis	00941	81%
Blast2go	Anthocyanin biosynthesis	00942	81%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	81%
Blast2go	Isoquinoline alkaloid biosynthesis	00950	81%
Blast2go	Insect hormone biosynthesis	00981	81%
Blast2go	Biosynthesis of type II polyketide products	01057	81%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	81%
Blast2go	Metabolic pathways	01100	81%
Blast2go	Biosynthesis of secondary metabolites	01110	81%

Source	GOs	Term	Type	Identity
Blast2go	phosphorylation	GO:0016310	Biological Process	81%
Blast2go	methylation	GO:0032259	Biological Process	81%
Blast2go	kinase activity	GO:0016301	Molecular Function	81%
Blast2go	methyltransferase activity	GO:0008168	Molecular Function	81%

Source	InterPros	Term	Type	Identity
Sma3	Glycoside hydrolase, family 10	IPR001000	-	-
Sma3	Zinc finger, RING-type	IPR001841	-	-
Sma3	Zinc finger, PHD-type	IPR001965	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	Putative S-adenosyl-L-methionine-dependent methyltransferase	IPR004159	-	-
Sma3	Cytokine-induced anti-apoptosis inhibitor 1	IPR007785	-	-
Sma3		IPR017909	-	-
Sma3	AT hook, DNA-binding motif	IPR017956	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-
Sma3	Zinc finger, C3HC4 RING-type	IPR018957	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LLQ2

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 47 aas, your sequence is shorter than subject: 82 - 635

Fln protein: VVTLAVTS*PWLSLYERGLIGTYQDWCEAFSTYPRTYDLIHAAGVFSMYQDRCDIANILLEMDRVLRPEGIVIIRDVVDVLG

Protein Length: 83

Fln nts: CGTCGTGACCTTGGCTGTCACGTCGTGACCTTGGCTGTCACTCTATGAGCGAGGATTAATTGGAACTTATCAGGACTGGTGTGAGGCTTTTTCAACATATCCTAGAACTTATGACTTAATTCATGCTGCCGGTGTCTTTAGCATGTATCAGGACAGGTGTGATATAGCTAACATACTTCTTGAGATGGACCGTGTCCTACGCCCTGAAGGGATCGTGATCATTAGGGATGTTGTTGATGTTCTTGGTG

Fln Alignment:

uagpf_mira_rep_c79718___LYERGLIGTYQDWCEAFSTYPRTYDLIHAAGVFSMYQDRCDIANILLEMDRVLRPEGIVIIRDVVDVL
B8LLQ2________________IYERGLIGTYMDWCEAFSTYPRTYDLIHANGIFSMYQDRCDMVDILLEMDRILRPEGAVIIRDSVDVL

SNPs (tot: 5)

Position	A %	C %	G %	T %	Probability
26	25		75		0.996486
28	25		75		0.996486
29	75	25			0.996478
44		50		25	0.995533
45	50			50	1.0

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain