SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene53458

Length: 262 nt

UniGene Fasta

>uagpf_v2_unigene53458
CGTCGTGACCTTGGCTGTCACTCAATTCCAATGAGCAGTTTAAATACACTTCCTCTGATACTTGACCGAGGATTTTTGGGTGTCTTGCATGACTGGTGCGAGGCATTTCCAACATATCCCAGAACATATGATATGCTTCATGCAGCAGGTCTACTTTCACAAGAATTCAATCATCAATATAAATGTGGGATGCTCGATCTATTTTTAGAGATGGATCGCATACTTAGGCCAGAGGGTTGGGTTGTACTTCGTGATGAAGTTC

Ace file of the UniGene uagpf_v2_unigene53458

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene1558	3/3

Source	Descriptions	Term	Type	Identity
AutoFact	ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9REF5_RICCO	-	-	62%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	61%
Blast2go	methyltransferase pmt4	-	-	76%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Transferring one-carbon groups, Methyltransferases.	EC:2.1.1.-	-	0.0	76%

Source	KEGGs	Term	Identity
Blast2go	Ubiquinone and other terpenoid-quinone biosynthesis	00130	76%
Blast2go	Tetracycline biosynthesis	00253	76%
Blast2go	Histidine metabolism	00340	76%
Blast2go	Tyrosine metabolism	00350	76%
Blast2go	Phenylalanine metabolism	00360	76%
Blast2go	Tryptophan metabolism	00380	76%
Blast2go	Benzoxazinoid biosynthesis	00402	76%
Blast2go	Selenocompound metabolism	00450	76%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	76%
Blast2go	Polycyclic aromatic hydrocarbon degradation	00624	76%
Blast2go	Methane metabolism	00680	76%
Blast2go	Porphyrin and chlorophyll metabolism	00860	76%
Blast2go	Carotenoid biosynthesis	00906	76%
Blast2go	Phenylpropanoid biosynthesis	00940	76%
Blast2go	Flavonoid biosynthesis	00941	76%
Blast2go	Anthocyanin biosynthesis	00942	76%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	76%
Blast2go	Isoquinoline alkaloid biosynthesis	00950	76%
Blast2go	Insect hormone biosynthesis	00981	76%
Blast2go	Biosynthesis of type II polyketide products	01057	76%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	76%
Blast2go	Metabolic pathways	01100	76%
Blast2go	Biosynthesis of secondary metabolites	01110	76%

Source	GOs	Term	Type	Identity
Blast2go	root development	GO:0048364	Biological Process	76%
Blast2go	shoot development	GO:0048367	Biological Process	76%
Blast2go	methylation	GO:0032259	Biological Process	76%
Blast2go	response to cytokinin stimulus	GO:0009735	Biological Process	76%
Blast2go	homogalacturonan biosynthetic process	GO:0010289	Biological Process	76%
Blast2go	methyltransferase activity	GO:0008168	Molecular Function	76%
Blast2go	Golgi apparatus	GO:0005794	Cellular Component	76%
Blast2go	vacuolar membrane	GO:0005774	Cellular Component	76%

Source	InterPros	Term	Type	e value	Identity
Sma3	Putative S-adenosyl-L-methionine-dependent methyltransferase	IPR004159	-	0.0	-
Sma3	Sugar transporter, conserved site	IPR005829	-	0.0	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LMQ4

Fln msg: Distance to subject end: 49 aas, your sequence is shorter than subject: 87 - 626

Fln protein: RRDLGCHSIPMSSLNTLPLILDRGFLGVLHDWCEAFPTYPRTYDMLHAAGLLSQEFNHQYKCGMLDLFLEMDRILRPEGWVVLRDEV

Protein Length: 88

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATTCCAATGAGCAGTTTAAATACACTTCCTCTGATACTTGACCGAGGATTTTTGGGTGTCTTGCATGACTGGTGCGAGGCATTTCCAACATATCCCAGAACATATGATATGCTTCATGCAGCAGGTCTACTTTCACAAGAATTCAATCATCAATATAAATGTGGGATGCTCGATCTATTTTTAGAGATGGATCGCATACTTAGGCCAGAGGGTTGGGTTGTACTTCGTGATGAAGTTC

Fln Alignment:

uagpf_mira_rep_c78301___NTLPLILDRGFLGVLHDWCEAFPTYPRTYDMLHAAGLLSQEFNHQYKCGMLDLFLEMDRILRPEGWVVLRDEV
B8LMQ4________________NTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHASGLLSM---YQDRCEISDILLEMDRILRPEGTVIFRDTV

SNPs (tot: 4)

Position	A %	C %	G %	T %	Probability
30	66		33		0.997458
31	66			33	0.997459
32		33		66	0.997459
34	66			33	0.997457

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain