UniGene Name: uagpf_v2_unigene50430
Length: 233 nt
UniGene Fasta |
---|
>uagpf_v2_unigene50430
C |
Ace file of the UniGene uagpf_v2_unigene50430 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene68925 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LUS3.1|PP237_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g16610 dbj|BAB02752.1| selenium-binding protein-like [Arabidopsis thaliana] gb|AEE75843.1| pentatricope | - | - | 2.0e-40 | 51% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
Blast2go | pentatricopeptide repeat-containing protein | - | - | 0.0 | 73% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 121 aas, your sequence is shorter than subject: 77 - 232
Fln protein:
V
Protein Length:
78
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c58035___AVTHLAALEQGMEIHEEIIRSGFQCNVFLCNALLDMYAKCGSIDKANEVFDKIHGKDVVSWNSMIAGYAMHGC
D5AB53________________ACANLAALEPGKVLHLYIIKSGFESDVFVGSTLIDMYAKCSSIGDASKVFDGMSTRNVVSWNAMIAAYAIHGC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain