UniGene Name: uagpf_v2_unigene48455
Length: 210 nt
UniGene Fasta |
---|
>uagpf_v2_unigene48455
C |
Ace file of the UniGene uagpf_v2_unigene48455 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene740 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative copper-exporting ATPase [Sorghum bicolor] | - | - | 0.0 | 62% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
Blast2go | copper-transporting atpase 3-like | - | - | 0.0 | 83% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Copper-exporting ATPase. | EC:3.6.3.4 | - | 0.0 | 83% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | 83% |
Blast2go | copper ion export | GO:0060003 | Biological Process | 0.0 | 83% |
Blast2go | copper ion binding | GO:0005507 | Molecular Function | 0.0 | 83% |
Blast2go | copper-exporting ATPase activity | GO:0004008 | Molecular Function | 0.0 | 83% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 83% |
Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 83% |
Blast2go | plastid | GO:0009536 | Cellular Component | 0.0 | 83% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ20
Fln msg: Distance to subject end: 48 aas, your sequence is shorter than subject: 70 - 998
Fln protein:
R
Protein Length:
71
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c50253___MAIGAGTDIAIEAADIVLVRNNLQDVITAIDLSRKTFFRIKLNYVWAFGYNILGIPIAAGV
B8LQ20________________MAIGAGTDIAIEAADYVLMRNNLEDVITAIDLSKKTFARIRLNYVFAMGYNIFAIPLAAGL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain