UniGene Name: uagpf_v2_unigene47808
Length: 242 nt
UniGene Fasta |
---|
>uagpf_v2_unigene47808
C |
Ace file of the UniGene uagpf_v2_unigene47808 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene6437 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Laccase n=2 Tax=Pinus taeda RepID=Q9AUI3_PINTA | - | - | 0.0 | 91% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Blast2go | laccase 12 | - | - | 0.0 | 89% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | L-ascorbate oxidase. | EC:1.10.3.3 | - | 0.0 | 89% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Ascorbate and aldarate metabolism | 00053 | 0.0 | 89% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 89% | |
Blast2go | Laccase. | EC:1.10.3.2 | - | 0.0 | 89% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | lignin catabolic process | GO:0046274 | Biological Process | 0.0 | 89% |
Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 89% |
Blast2go | copper ion binding | GO:0005507 | Molecular Function | 0.0 | 89% |
Blast2go | L-ascorbate oxidase activity | GO:0008447 | Molecular Function | 0.0 | 89% |
Blast2go | laccase activity | GO:0008471 | Molecular Function | 0.0 | 89% |
Blast2go | endomembrane system | GO:0012505 | Cellular Component | 0.0 | 89% |
Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 89% |
Blast2go | apoplast | GO:0048046 | Cellular Component | 0.0 | 89% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | Oxidoreductase, molybdopterin-binding domain | IPR000572 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
Sma3 | Bacterial extracellular solute-binding family 1, conserved site | IPR006061 | - | 0.0 | - |
Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Laccase | IPR017761 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPF9
Fln msg: Distance to subject end: 23 aas, your sequence is shorter than subject: 80 - 573
Fln protein:
R
Protein Length:
81
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c49303___LHGYDFYIVGEGFGNYNPRTDPLTFNLVDPPMRNTVAVPVNGWAAIRFVADNPGAWLMHCHLDVHITWGLAM
B8LPF9________________LHGYDFYIVGEGFGNYNPRTDPQKFNLVDPPLRNTVAVPVNGWAAIRFVADNPGAWLMHCHLDVHITWGLAM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain