|
||||||
|
UniGene Name: uagpf_v2_unigene47318
Length: 172 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene47318
C |
|
Ace file of the UniGene uagpf_v2_unigene47318
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene64540 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Dicer-like protein n=1 Tax=Populus trichocarpa RepID=B9GRS6_POPTR | - | - | 0.0 | 85% |
| FL-Next | sp=Endoribonuclease Dicer homolog 1; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 81% |
| Blast2go | endoribonuclease dicer | - | - | 0.0 | 89% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | 89% |
| Blast2go | suspensor development | GO:0010098 | Biological Process | 0.0 | 89% |
| Blast2go | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | 89% |
| Blast2go | mRNA cleavage involved in gene silencing by miRNA | GO:0035279 | Biological Process | 0.0 | 89% |
| Blast2go | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | 89% |
| Blast2go | production of miRNAs involved in gene silencing by miRNA | GO:0035196 | Biological Process | 0.0 | 89% |
| Blast2go | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | 89% |
| Blast2go | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | 89% |
| Blast2go | cytokinesis | GO:0000910 | Biological Process | 0.0 | 89% |
| Blast2go | protein binding | GO:0005515 | Molecular Function | 0.0 | 89% |
| Blast2go | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | 89% |
| Blast2go | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | 89% |
| Blast2go | nuclear dicing body | GO:0010445 | Cellular Component | 0.0 | 89% |
| Blast2go | regulation of seed maturation | GO:2000034 | Biological Process | 0.0 | 89% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
| Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
| Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
| Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
| Sma3 | Helicase/UvrB domain | IPR006935 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
| Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8LMR2
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 1565 aas, your sequence is shorter than subject: 56 - 1883
Fln protein:
S
Protein Length:
57
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c48566___YQLEVLEQARVKNTIAFLETGAGKTLIAVLLMQSVCRDMRKENRKMLA
Q8LMR2________________YQLEVLEQAKSRNTIAFLETGAGKTLIAVLLIKSVCDKMLKENKKMLA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
