UniGene Name: uagpf_v2_unigene47165
Length: 215 nt
UniGene Fasta |
---|
>uagpf_v2_unigene47165
C |
Ace file of the UniGene uagpf_v2_unigene47165 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene693 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA topoisomerase 2 (Fragment) n=1 Tax=Vitis vinifera RepID=D7T341_VITVI | - | - | 0.0 | 75% |
FL-Next | sp=DNA topoisomerase 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 75% |
Blast2go | dna topoisomerase ii | - | - | 0.0 | 84% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | 2-alkenal reductase. | EC:1.3.1.74 | - | 0.0 | 84% |
Blast2go | DNA topoisomerase (ATP-hydrolyzing). | EC:5.99.1.3 | - | 0.0 | 84% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 84% |
Blast2go | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | 84% |
Blast2go | chromosome segregation | GO:0007059 | Biological Process | 0.0 | 84% |
Blast2go | DNA topological change | GO:0006265 | Biological Process | 0.0 | 84% |
Blast2go | 2-alkenal reductase [NAD(P)] activity | GO:0032440 | Molecular Function | 0.0 | 84% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 84% |
Blast2go | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | 84% |
Blast2go | DNA topoisomerase (ATP-hydrolyzing) activity | GO:0003918 | Molecular Function | 0.0 | 84% |
Blast2go | DNA-dependent ATPase activity | GO:0008094 | Molecular Function | 0.0 | 84% |
Blast2go | DNA topoisomerase complex (ATP-hydrolyzing) | GO:0009330 | Cellular Component | 0.0 | 84% |
Blast2go | chromosome | GO:0005694 | Cellular Component | 0.0 | 84% |
Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 84% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA topoisomerase, type IIA | IPR001241 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit A/C-terminal | IPR002205 | - | 0.0 | - |
Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit B, domain 2 | IPR013506 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit A, alpha-helical | IPR013757 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit A/ C-terminal, alpha-beta | IPR013758 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit B/N-terminal, alpha-beta | IPR013759 | - | 0.0 | - |
Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P30182
Fln msg: Distance to subject end: 850 aas, your sequence is shorter than subject: 71 - 1473
Fln protein:
V
Protein Length:
72
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c48343___SLLKIPSFLVEFITPIVKATHKDGR-VLSFYTMPEYESWRESLGGTASGWTIKYYKGLGTSTSK
P30182________________SLLQVPSFLVEFITPIVKATRKGTKKVLSFYSMPEYEEWKESLKGNATGWDIKYYKGLGTSTAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain