UniGene Name: uagpf_v2_unigene46981
Length: 218 nt
![]() |
---|
>uagpf_v2_unigene46981
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene76255 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pol protein integrase region (Fragment) n=1 Tax=Pinus brutia RepID=Q9M6N4_9CONI | - | - | 2.0e-30 | 98% |
FL-Next | tr=RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold; Medicago truncatula (Barrel medic) (Medicago tribuloides). | - | - | 0.0 | 75% |
Blast2go | pol protein integrase region | - | - | 2.85279e-40 | 83% |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A2Q2C7
Fln msg: Distance to subject end: 246 aas, your sequence is shorter than subject: 72 - 1297
Fln protein:
V
Protein Length:
73
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c48091___KLHGMPTSIVSDRDPIFTSNFWQELFRIQGTQLKLSTSYHPQTDSQTEAVNKCLETYLRCF
A2Q2C7________________RLHGIPLSIVSDRDPIFMSNFWKELFKLQGTKLKMSIAYHPETDGQTEVVNRCLETYLRCF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain