|
||||||
|
UniGene Name: uagpf_v2_unigene46652
Length: 199 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene46652
C |
|
Ace file of the UniGene uagpf_v2_unigene46652
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene9324 | 1/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | dihydropterin pyrophosphokinase /dihydropteroate synthase [Pisum sativum] | - | - | 0.0 | 63% |
| FL-Next | tr=Dihydropteroate synthase, putative; Ricinus communis (Castor bean). | - | - | 0.0 | 63% |
| Blast2go | dihydropterin pyrophosphokinase dihydropteroate synthase | - | - | 0.0 | 80% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Dihydropteroate synthase. | EC:2.5.1.15 | - | 0.0 | 80% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Folate biosynthesis | 00790 | 0.0 | 80% | |
| Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 80% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 80% | |
| Blast2go | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase. | EC:2.7.6.3 | - | 0.0 | 80% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Folate biosynthesis | 00790 | 0.0 | 80% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 80% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | 80% |
| Blast2go | tetrahydrofolate biosynthetic process | GO:0046654 | Biological Process | 0.0 | 80% |
| Blast2go | folic acid biosynthetic process | GO:0046656 | Biological Process | 0.0 | 80% |
| Blast2go | phosphorylation | GO:0016310 | Biological Process | 0.0 | 80% |
| Blast2go | dihydropteroate synthase activity | GO:0004156 | Molecular Function | 0.0 | 80% |
| Blast2go | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity | GO:0003848 | Molecular Function | 0.0 | 80% |
| Blast2go | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | 80% |
| Blast2go | kinase activity | GO:0016301 | Molecular Function | 0.0 | 80% |
| Blast2go | cytosol | GO:0005829 | Cellular Component | 0.0 | 80% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 80% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pterin-binding | IPR000489 | - | 0.0 | - |
| Sma3 | 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK | IPR000550 | - | 0.0 | - |
| Sma3 | Dihydropteroate synthase | IPR006390 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9S4E5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 257 aas, your sequence is shorter than subject: 65 - 487
Fln protein:
S
Protein Length:
66
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c47623___ILGLGADNDTVACWHALSGRNGGIFEAWEKLGGEDLMGREGMKRVLPIGNELLDWSRK
B9S4E5________________LLGSDIENDTVACWHSLSIHSGGLFESWENLGGENLIGKDGMKRVIPAGNQLLDWSQR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
