UniGene Name: uagpf_v2_unigene46593
Length: 217 nt
UniGene Fasta
|
|---|
| >uagpf_v2_unigene46593
C |
Ace file of the UniGene uagpf_v2_unigene46593
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene2928 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 1,3-beta-glucan synthase, putative n=1 Tax=Ricinus communis RepID=B9SQ54_RICCO | - | - | 0.0 | 76% |
| FL-Next | sp=Callose synthase 10; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
| Blast2go | callose synthase | - | - | 0.0 | 86% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | 1,3-beta-glucan synthase. | EC:2.4.1.34 | - | 0.0 | 86% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Starch and sucrose metabolism | 00500 | 0.0 | 86% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | (1->3)-beta-D-glucan biosynthetic process | GO:0006075 | Biological Process | 0.0 | 86% |
| Blast2go | callose deposition in cell wall | GO:0052543 | Biological Process | 0.0 | 86% |
| Blast2go | microsporogenesis | GO:0009556 | Biological Process | 0.0 | 86% |
| Blast2go | regulation of pollen tube growth | GO:0080092 | Biological Process | 0.0 | 86% |
| Blast2go | generative cell mitosis | GO:0055047 | Biological Process | 0.0 | 86% |
| Blast2go | pollen germination | GO:0009846 | Biological Process | 0.0 | 86% |
| Blast2go | 1,3-beta-D-glucan synthase activity | GO:0003843 | Molecular Function | 0.0 | 86% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 86% |
| Blast2go | 1,3-beta-D-glucan synthase complex | GO:0000148 | Cellular Component | 0.0 | 86% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Glycosyl transferase, family 48 | IPR003440 | - | 0.0 | - |
| Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
| Sma3 | K Homology domain, type 1 | IPR004088 | - | 0.0 | - |
| Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SJM0
Fln msg: Distance to subject end: 758 aas, your sequence is shorter than subject: 72 - 1909
Fln protein:
V
Protein Length:
73
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c47541___VFTPYYKETVMYSITELEKENEDGISTVFYLQKIFPDEWKIFLERIGRDEHTLVSELKENPND
Q9SJM0________________VFTPYYSETVLYSSSELRSENEDGISILFYLQKIFPDEWENFLERIGRSESTGDADLQASSTD

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta