UniGene Name: uagpf_v2_unigene46416
Length: 172 nt
UniGene Fasta
|
|---|
| >uagpf_v2_unigene46416
C |
Ace file of the UniGene uagpf_v2_unigene46416
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene14016 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | WAK-like kinase n=1 Tax=Solanum lycopersicum RepID=Q6QLL5_SOLLC | - | - | 0.0 | 56% |
| FL-Next | sp=Wall-associated receptor kinase-like 14; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 51% |
| Blast2go | wall-associated receptor kinase-like 14-like | - | - | 0.0 | 72% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 72% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | phosphorylation | GO:0016310 | Biological Process | 0.0 | 72% |
| Blast2go | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | 72% |
| Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 72% |
| Blast2go | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | 72% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8RY67
Fln msg: Distance to subject end: 448 aas, your sequence is shorter than subject: 57 - 708
Fln protein:
R
Protein Length:
58
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c47291___QLGWWIEGDC-SNKCSTNGNCTQFVSPNTGNPVHKCSCNDGFVGDGY
Q8RY67________________RLGWWLKGGCESGTCAANTDCTDVETPH-GYAGHRCSCLDGFHGDGY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta