SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene46261

Length: 364 nt

UniGene Fasta

>uagpf_v2_unigene46261
CGTCGTGACCTTGGCTGTCACTCATGTTGCTAGGAAGGTATTTTCGCATCTTCATGATCTTGACCTTCAGTATCATTTAAGTCGTCAAACTGGGGCATTAAGTCGTACAATTGATCGTGGAACGCGTGGGATAAATTTCATTCTTTCTTCCATGGTATTCAATGTTGTACCGACTATATTAGAGATATCAATGGTTGCAGGCATTTTAGCATATAAGTTTGGTGCTCCATTTGCATTGGTTACATCTCTTGCTGTTGGCGGTTATGTTGCTTTCACCTTGTTTGTGACACAGTGGCGGACCAAATTTCGACAGGTTATGAACAAAGCTGACAATGATGCAAATCACGGGCTATTGATTCACTCA

Ace file of the UniGene uagpf_v2_unigene46261

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene12252	1/2

Source	Descriptions	Term	Type	Identity
AutoFact	Whole genome shotgun sequence of line PN40024, scaffold_4.assembly12x (Fragment) n=2 Tax=Vitis vinifera RepID=D7SJG4_VITVI	-	-	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	32%
Blast2go	abc transporter family of the mitochondria family	-	-	79%

Source	GOs	Term	Type	Identity
Blast2go	root development	GO:0048364	Biological Process	79%
Blast2go	Mo-molybdopterin cofactor biosynthetic process	GO:0006777	Biological Process	79%
Blast2go	positive regulation of catalytic activity	GO:0043085	Biological Process	79%
Blast2go	cellular iron ion homeostasis	GO:0006879	Biological Process	79%
Blast2go	gibberellic acid mediated signaling pathway	GO:0009740	Biological Process	79%
Blast2go	actin filament-based movement	GO:0030048	Biological Process	79%
Blast2go	positive regulation of programmed cell death	GO:0043068	Biological Process	79%
Blast2go	pollen development	GO:0009555	Biological Process	79%
Blast2go	chloroplast organization	GO:0009658	Biological Process	79%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	79%
Blast2go	response to cold	GO:0009409	Biological Process	79%
Blast2go	response to lead ion	GO:0010288	Biological Process	79%
Blast2go	transmembrane transport	GO:0055085	Biological Process	79%
Blast2go	positive regulation of transcription, DNA-dependent	GO:0045893	Biological Process	79%
Blast2go	ATP catabolic process	GO:0006200	Biological Process	79%
Blast2go	regulation of multicellular organism growth	GO:0040014	Biological Process	79%
Blast2go	positive regulation of abscisic acid mediated signaling pathway	GO:0009789	Biological Process	79%
Blast2go	response to oxidative stress	GO:0006979	Biological Process	79%
Blast2go	regulation of chlorophyll biosynthetic process	GO:0010380	Biological Process	79%
Blast2go	enzyme activator activity	GO:0008047	Molecular Function	79%
Blast2go	motor activity	GO:0003774	Molecular Function	79%
Blast2go	DNA binding	GO:0003677	Molecular Function	79%
Blast2go	ATPase activity, coupled to transmembrane movement of substances	GO:0042626	Molecular Function	79%
Blast2go	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	79%
Blast2go	ATP binding	GO:0005524	Molecular Function	79%
Blast2go	chloroplast envelope	GO:0009941	Cellular Component	79%
Blast2go	apoplast	GO:0048046	Cellular Component	79%
Blast2go	stromule	GO:0010319	Cellular Component	79%
Blast2go	phragmoplast	GO:0009524	Cellular Component	79%
Blast2go	integral to membrane	GO:0016021	Cellular Component	79%
Blast2go	chloroplast stroma	GO:0009570	Cellular Component	79%
Blast2go	chloroplast thylakoid	GO:0009534	Cellular Component	79%
Blast2go	cell plate	GO:0009504	Cellular Component	79%
Blast2go	plasma membrane	GO:0005886	Cellular Component	79%
Blast2go	nucleus	GO:0005634	Cellular Component	79%
Blast2go	myosin complex	GO:0016459	Cellular Component	79%
Blast2go	mitochondrion	GO:0005739	Cellular Component	79%

Source	InterPros	Term	Type	Identity
Sma3	ABC transporter, transmembrane domain	IPR001140	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NW03

Fln msg: Distance to subject end: 314 aas, your sequence is shorter than subject: 121 - 636

Fln protein: VVTLAVTHVARKVFSHLHDLDLQYHLSRQTGALSRTIDRGTRGINFILSSMVFNVVPTILEISMVAGILAYKFGAPFALVTSLAVGGYVAFTLFVTQWRTKFRQVMNKADNDANHGLLIHS

Protein Length: 122

Fln nts: CGTCGTGACCTTGGCTGTCACTCATGTTGCTAGGAAGGTATTTTCGCATCTTCATGATCTTGACCTTCAGTATCATTTAAGTCGTCAAACTGGGGCATTAAGTCGTACAATTGATCGTGGAACGCGTGGGATAAATTTCATTCTTTCTTCCATGGTATTCAATGTTGTACCGACTATATTAGAGATATCAATGGTTGCAGGCATTTTAGCATATAAGTTTGGTGCTCCATTTGCATTGGTTACATCTCTTGCTGTTGGCGGTTATGTTGCTTTCACCTTGTTTGTGACACAGTGGCGGACCAAATTTCGACAGGTTATGAACAAAGCTGACAATGATGCAAATCACGGGCTATTGATTCACTCA

Fln Alignment:

uagpf_mira_rep_c47067___VFSHLHDLDLQYHLSRQTGALSRTIDRGTRGINFILSSMVFNVVPTILEISMVAGILAYKFGAPFALVTSLAVGGYVAFTLFVTQWRTKFRQVMNK
A9NW03________________LLQHILYLDLSFHLDKSSGVLLRILERAQRSVIHIFRAVVFTFIPTAIELVLVCALLSHQVGAAVAGIVLLAFLAYVIWTVKITTAAALSRIKANK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain