UniGene Name: uagpf_v2_unigene44935
Length: 222 nt
UniGene Fasta
|
|---|
| >uagpf_v2_unigene44935
C |
Ace file of the UniGene uagpf_v2_unigene44935
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3187 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Whole genome shotgun sequence of line PN40024, scaffold_8.assembly12x (Fragment) n=2 Tax=Vitis vinifera RepID=D7SV05_VITVI | - | - | 0.0 | 56% |
| FL-Next | sp=Histone-lysine N-methyltransferase ATX3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 50% |
| Blast2go | histone-lysine n-methyltransferase | - | - | 0.0 | 63% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 63% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | primary metabolic process | GO:0044238 | Biological Process | 0.0 | 63% |
| Blast2go | cellular macromolecule metabolic process | GO:0044260 | Biological Process | 0.0 | 63% |
| Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 63% |
| Blast2go | binding | GO:0005488 | Molecular Function | 0.0 | 63% |
| Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 63% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 63% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PWWP | IPR000313 | - | 0.0 | - |
| Sma3 | SET domain | IPR001214 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | Protein kinase C-like, phorbol ester/diacylglycerol binding | IPR002219 | - | 0.0 | - |
| Sma3 | GYF | IPR003169 | - | 0.0 | - |
| Sma3 | Post-SET domain | IPR003616 | - | 0.0 | - |
| Sma3 | Histone-lysine N-methyltransferase | IPR015722 | - | 0.0 | - |
| Sma3 | AT hook, DNA-binding motif | IPR017956 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9M364
Fln msg: Distance to subject end: 52 aas, your sequence is shorter than subject: 74 - 1018
Fln protein:
R
Protein Length:
75
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c45103___HSGEIVGLRVADKREVNYHSRGKMQYEGACYFFRIDKESIIDATRKGGIARFVNHSCSPNCVAKVISV
Q9M364________________YRGVKVRRSVADLREANYRSQGK-----DCYLFKISEEIVIDATDSGNIARLINHSCMPNCYARIVSM

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta