|
||||||
|
UniGene Name: uagpf_v2_unigene44747
Length: 218 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene44747
C |
|
Ace file of the UniGene uagpf_v2_unigene44747
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene1582 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative methylase [Arabidopsis thaliana] gb|AAO64787.1| At4g28830 [Arabidopsis thaliana] dbj|BAE99501.1| hypothetical protein [Arabidopsis thaliana] gb|AEE85551.1| putative methylase [Arabidopsis thaliana] | - | - | 0.0 | 61% |
| FL-Next | tr=At4g28830; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 74% |
| Blast2go | methyltransferase-like protein | - | - | 0.0 | 82% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 82% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 82% |
| Blast2go | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | 82% |
| Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 82% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Putative RNA methylase | IPR000241 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Carotenoid oxygenase | IPR004294 | - | 0.0 | - |
| Sma3 | Methyltransferase small | IPR007848 | - | 0.0 | - |
| Sma3 | Ribosomal L11 methyltransferase, PrmA | IPR010456 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: tr_plants
Fln subject: Q84TF1
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 2 aas, your sequence is shorter than subject: 72 - 208
Fln protein:
S
Protein Length:
73
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c44800___ISTGAVYSLHKTSTREHVKRTAIRDLNAKTAEVLCELRFDLPALYKFHKKREVDIGVDL
Q84TF1________________VASKAVYSLHKTSTREHIKRAALRDFNAKSAEVICELRYDLPKLYKFHKRKEVDIAVDL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
