UniGene Name: uagpf_v2_unigene44302
Length: 230 nt
![]() |
---|
>uagpf_v2_unigene44302
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene1695 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | NADH-cytochrome b5 reductase-like protein [Arabidopsis thaliana] sp|P83291.2|NCB5R_ARATH RecName: Full=NADH-cytochrome b5 reductase-like protein; Short=B5R gb|AAM64833.1| cytochrome-b5 reductase-like protein [Arabidopsis thaliana] gb|ABD59058.1| At5g20080 | - | - | 0.0 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Blast2go | nadh-cytochrome b5 reductase-like protein | - | - | 0.0 | 81% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Cytochrome-b5 reductase. | EC:1.6.2.2 | - | 0.0 | 81% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 81% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | response to salt stress | GO:0009651 | Biological Process | 0.0 | 81% |
Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 81% |
Blast2go | cytochrome-b5 reductase activity | GO:0004128 | Molecular Function | 0.0 | 81% |
Blast2go | copper ion binding | GO:0005507 | Molecular Function | 0.0 | 81% |
Blast2go | mitochondrial intermembrane space | GO:0005758 | Cellular Component | 0.0 | 81% |
Blast2go | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | 81% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidoreductase, molybdopterin-binding domain | IPR000572 | - | 0.0 | - |
Sma3 | Cytochrome b5 | IPR001199 | - | 0.0 | - |
Sma3 | Oxidoreductase FAD/NAD(P)-binding | IPR001433 | - | 0.0 | - |
Sma3 | Flavoprotein pyridine nucleotide cytochrome reductase | IPR001709 | - | 0.0 | - |
Sma3 | NADH:cytochrome b5 reductase (CBR) | IPR001834 | - | 0.0 | - |
Sma3 | Basic-leucine zipper domain | IPR004827 | - | 0.0 | - |
Sma3 | Moybdenum cofactor oxidoreductase, dimerisation | IPR005066 | - | 0.0 | - |
Sma3 | Oxidoreductase, FAD-binding domain | IPR008333 | - | 0.0 | - |
Sma3 | Eukaryotic molybdopterin oxidoreductase | IPR008335 | - | 0.0 | - |
Sma3 | bZIP transcription factor, bZIP-1 | IPR011616 | - | 0.0 | - |
Sma3 | Nitrate reductase NADH dependent | IPR012137 | - | 0.0 | - |
Sma3 | Ferredoxin reductase-type FAD-binding domain | IPR017927 | - | 0.0 | - |
Sma3 | Cytochrome b5, heme-binding site | IPR018506 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NRC8
Fln msg: Distance to subject end: 51 aas, your sequence is shorter than subject: 76 - 281
Fln protein:
V
Protein Length:
77
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c44128___GTGITPMLQIIDAILKNPEDITKVSLLYANVSPDDILLKEKLDALSYSHP-NFKVYYVVDKPVSGWRGG
A9NRC8________________GSGITPMFQVTRAILENPKDKTNVYLIYGNVTYEDILLKDELDSLMKNYPGRFRVYHVLNQPPEGWTGG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain