UniGene Name: uagpf_v2_unigene44202
Length: 179 nt
UniGene Fasta |
---|
>uagpf_v2_unigene44202
C |
Ace file of the UniGene uagpf_v2_unigene44202 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene2421 | 1/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Transitional endoplasmic reticulum ATPase-like n=3 Tax=Oryza sativa RepID=Q6YUV9_ORYSJ | - | - | 0.0 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Blast2go | p-loop containing ntpase domain-containing protein | - | - | 0.0 | 79% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 0.0 | 79% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | microtubule-severing ATPase activity | GO:0008568 | Molecular Function | 0.0 | 79% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 79% |
Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P2N1
Fln msg: Distance to subject end: 179 aas, your sequence is shorter than subject: 59 - 439
Fln protein:
V
Protein Length:
60
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c43992___AEKLTKALFSFASRLAPVIIFIDEVDSILGARGGASEHEATRRMRNE
A9P2N1________________SEKLVSNLFQMARDCAPSIIFIDEIDSLCGQRGEGNESEASRRIKTE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain