UniGene Name: uagpf_v2_unigene43767
Length: 225 nt
UniGene Fasta |
---|
>uagpf_v2_unigene43767
C |
Ace file of the UniGene uagpf_v2_unigene43767 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene13504 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA mismatch repair protein PMS2 [Arabidopsis thaliana] gb|AAL01156.1| DNA mismatch repair protein [Arabidopsis thaliana] gb|AEE82175.1| DNA mismatch repair protein PMS2 [Arabidopsis thaliana] | - | - | 2.99878e-43 | 62% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 70% |
Blast2go | mismatch repair endonuclease pms2-like | - | - | 2.10195e-44 | 81% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | pollen development | GO:0009555 | Biological Process | 2.10195e-44 | 81% |
Blast2go | mismatch repair | GO:0006298 | Biological Process | 2.10195e-44 | 81% |
Blast2go | seed development | GO:0048316 | Biological Process | 2.10195e-44 | 81% |
Blast2go | DNA recombination | GO:0006310 | Biological Process | 2.10195e-44 | 81% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 2.10195e-44 | 81% |
Blast2go | mismatched DNA binding | GO:0030983 | Molecular Function | 2.10195e-44 | 81% |
Blast2go | nucleus | GO:0005634 | Cellular Component | 2.10195e-44 | 81% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D7U271
Fln msg: Distance to subject end: 697 aas, your sequence is shorter than subject: 74 - 854
Fln protein:
V
Protein Length:
75
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c43306___FSDLESLTSFGFRGEALSSLCALGDVTIVTRTRHETVGTQLSFDHSGLISSQKSMARQIGTTVTV
D7U271________________FPDLQSLTTFGFRGEALSSLCALGNLTVETRTKNESVATHLTFDHSGLLRDEKKTARQIGTTVTV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain