UniGene Name: uagpf_v2_unigene43721
Length: 243 nt
UniGene Fasta
|
|---|
| >uagpf_v2_unigene43721
C |
Ace file of the UniGene uagpf_v2_unigene43721
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene920 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative 97B2-like cytochrome P450 n=1 Tax=Ginkgo biloba RepID=Q6J4G9_GINBI | - | - | 0.0 | 88% |
| FL-Next | sp=Cytochrome P450 97B1, chloroplastic; Pisum sativum (Garden pea). | - | - | 0.0 | 77% |
| Blast2go | cytochrome p450 | - | - | 0.0 | 86% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Unspecific monooxygenase. | EC:1.14.14.1 | - | 0.0 | 86% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Fatty acid metabolism | 00071 | 0.0 | 86% | |
| Blast2go | Steroid hormone biosynthesis | 00140 | 0.0 | 86% | |
| Blast2go | Caffeine metabolism | 00232 | 0.0 | 86% | |
| Blast2go | Tryptophan metabolism | 00380 | 0.0 | 86% | |
| Blast2go | Arachidonic acid metabolism | 00590 | 0.0 | 86% | |
| Blast2go | Linoleic acid metabolism | 00591 | 0.0 | 86% | |
| Blast2go | Aminobenzoate degradation | 00627 | 0.0 | 86% | |
| Blast2go | Retinol metabolism | 00830 | 0.0 | 86% | |
| Blast2go | Metabolism of xenobiotics by cytochrome P450 | 00980 | 0.0 | 86% | |
| Blast2go | Drug metabolism - cytochrome P450 | 00982 | 0.0 | 86% | |
| Blast2go | Drug metabolism - other enzymes | 00983 | 0.0 | 86% | |
| Blast2go | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | 86% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 86% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 86% |
| Blast2go | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | 86% |
| Blast2go | heme binding | GO:0020037 | Molecular Function | 0.0 | 86% |
| Blast2go | oxygen binding | GO:0019825 | Molecular Function | 0.0 | 86% |
| Blast2go | aromatase activity | GO:0070330 | Molecular Function | 0.0 | 86% |
| Blast2go | chloroplast membrane | GO:0031969 | Cellular Component | 0.0 | 86% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 86% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tropomyosin | IPR000533 | - | 0.0 | - |
| Sma3 | ATPase, F1 complex, OSCP/delta subunit | IPR000711 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase active site | IPR006650 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - | |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q43078
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 94 aas, your sequence is shorter than subject: 81 - 552
Fln protein:
R
Protein Length:
82
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c43246___YIRLIIAEALRLYPQPPLLIRRALQPDTLPGGYRGDKDGYPIPRGTDI
Q43078________________YIRLIVVETLRLYPQPPLLIRRSLKPDVLPGGHKGDKDGYTIPAGTDV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta