UniGene Name: uagpf_v2_unigene42915
Length: 247 nt
UniGene Fasta |
---|
>uagpf_v2_unigene42915
C |
Ace file of the UniGene uagpf_v2_unigene42915 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene72864 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] sp|C0LGG9.2|Y5344_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At1g53440; Flags: Precursor gb|AEE32941.1| putative LRR receptor-like serine | - | - | 8.0e-14 | 50% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 46% |
Blast2go | leucine-rich repeat transmembrane protein kinase | - | - | 3.28164e-16 | 67% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 3.28164e-16 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPW7
Fln msg: Distance to subject end: 297 aas, your sequence is shorter than subject: 82 - 702
Fln protein:
V
Protein Length:
83
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c42005___HSTDNDEGEELVL--LNNRHIIFTMETLLASTKNFDNQNKLGEGGFGPVYKGTTPDGKEIAVKKLSFKSMQ
C0PPW7________________YRTGGDEGDSVLMPTIANPELIFKFDILRESTSNFKAENKLGEGGFGSVFKGVLPDGREVAVKRLFMGTRQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain