UniGene Name: uagpf_v2_unigene42897
Length: 214 nt
UniGene Fasta |
---|
>uagpf_v2_unigene42897
C |
Ace file of the UniGene uagpf_v2_unigene42897 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene70948 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] emb|CAB68154.1| myosin heavy chain MYA3 [Arabidopsis thaliana] gb|AEE79749.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] | - | - | 7.0e-16 | 72% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 86% |
Blast2go | myosin-h heavy chain-like | - | - | 5.53159e-17 | 82% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | root hair cell tip growth | GO:0048768 | Biological Process | 5.53159e-17 | 82% |
Blast2go | peroxisome localization | GO:0060151 | Biological Process | 5.53159e-17 | 82% |
Blast2go | fruit development | GO:0010154 | Biological Process | 5.53159e-17 | 82% |
Blast2go | cell division | GO:0051301 | Biological Process | 5.53159e-17 | 82% |
Blast2go | post-embryonic development | GO:0009791 | Biological Process | 5.53159e-17 | 82% |
Blast2go | mitochondrion localization | GO:0051646 | Biological Process | 5.53159e-17 | 82% |
Blast2go | trichome branching | GO:0010091 | Biological Process | 5.53159e-17 | 82% |
Blast2go | Golgi localization | GO:0051645 | Biological Process | 5.53159e-17 | 82% |
Blast2go | vacuole | GO:0005773 | Cellular Component | 5.53159e-17 | 82% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IQ motif, EF-hand binding site | IPR000048 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Myosin head, motor domain | IPR001609 | - | 0.0 | - |
Sma3 | Dilute | IPR002710 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | HAMP linker domain | IPR003660 | - | 0.0 | - |
Sma3 | Myosin, N-terminal, SH3-like | IPR004009 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Dil domain | IPR018444 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6HS30
Fln msg: Separated hits, possible frame ERROR between 87 and 89, Unexpected STOP codon at 3' end. Distance to subject end: 1167 aas, your sequence is shorter than subject: 71 - 1488
Fln protein:
R
Protein Length:
72
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c41979___HSF*MLCAAPPEDIEKYKLGDPRxFHYLKQSNCYELDGVNGAEEYLVARRAMDVVGISPEEQ
F6HS30________________HCFYMLCAAPPEDVEKYKLGDPRxFHYLNQSNCYELDGVNDSKEYLATRRAMNVVGISSVEQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain