UniGene Name: uagpf_v2_unigene41686
Length: 183 nt
UniGene Fasta |
---|
>uagpf_v2_unigene41686
C |
Ace file of the UniGene uagpf_v2_unigene41686 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene935 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | copper-transporting P-type ATPase [Brassica napus] | - | - | 0.0 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Blast2go | copper-transporting atpase ran1-like isoform 1 | - | - | 0.0 | 85% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Copper-exporting ATPase. | EC:3.6.3.4 | - | 0.0 | 85% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | 85% |
Blast2go | copper ion export | GO:0060003 | Biological Process | 0.0 | 85% |
Blast2go | copper ion binding | GO:0005507 | Molecular Function | 0.0 | 85% |
Blast2go | copper-exporting ATPase activity | GO:0004008 | Molecular Function | 0.0 | 85% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 85% |
Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 85% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ20
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 194 aas, your sequence is shorter than subject: 60 - 998
Fln protein:
S
Protein Length:
61
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c40213___ILVGNRKLMSEDGVSIPSVAEDNLKDMEQHARTGILVAFDRRLVGMLAISDP
B8LQ20________________ILVGNRKLMSEDGVFIPSVAEEYLKDMEQHARTGILVAFDKELVGMLAISDP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain