SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene41387

Length: 337 nt

UniGene Fasta

>uagpf_v2_unigene41387
CGTCGTGACCTTGGCTGTCACTCATTTTTGCTATGTTGAGAATCTGGTATTGTTAGCAGACGAGGTTTATCAACAAAATATTTATCAGGATGAGCGCCCCTTTGTAAGCGCAAAGAAGGTTTTGATGGACATGGGCTTACCTTTCAGCAAAGAACTCCAACTTGTGTCATATCATACTGTATCGAAAGGATACTGGGGTGAGTGTGGGCAGCGTGGAGGATATTTTGAAATGACAAACATTCCTCCTAAGACAGTTGATGAGATATATAAAGTGGCATCAATATCTCTAAGTCCTAATGTGCCCGGTCAAGTATTTCTAGGATTGATGGTTAATCCA

Ace file of the UniGene uagpf_v2_unigene41387

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene1786	3/3

Source	Descriptions	Term	Type	Identity
AutoFact	alanine aminotransferase [Oryza sativa Indica Group]	-	-	80%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	98%
Blast2go	alanine-2-oxoglutarate aminotransferase 2	-	-	90%

Source	ECs	Term	Type	e value	Identity
Blast2go	Alanine--glyoxylate transaminase.	EC:2.6.1.44	-	0.0	90%

Source	KEGGs	Term	Type	Identity
Blast2go	Alanine, aspartate and glutamate metabolism	00250		90%
Blast2go	Glycine, serine and threonine metabolism	00260		90%
Blast2go	Metabolic pathways	01100		90%
Blast2go	Gamma-glutamyltransferase.	EC:2.3.2.2	-	90%

Source	KEGGs	Term	Type	Identity
Blast2go	Cyanoamino acid metabolism	00460		90%
Blast2go	Glutathione metabolism	00480		90%
Blast2go	Arachidonic acid metabolism	00590		90%
Blast2go	Metabolic pathways	01100		90%
Blast2go	1-aminocyclopropane-1-carboxylate synthase.	EC:4.4.1.14	-	90%

Source	KEGGs	Term	Type	Identity
Blast2go	Cysteine and methionine metabolism	00270		90%
Blast2go	Biosynthesis of plant hormones	01070		90%
Blast2go	Metabolic pathways	01100		90%
Blast2go	Biosynthesis of secondary metabolites	01110		90%
Blast2go	Alanine transaminase.	EC:2.6.1.2	-	90%

Source	KEGGs	Term	Type	Identity
Blast2go	Alanine, aspartate and glutamate metabolism	00250		90%
Blast2go	Carbon fixation in photosynthetic organisms	00710		90%
Blast2go	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064		90%
Blast2go	Metabolic pathways	01100		90%
Blast2go	Glutathione gamma-glutamylcysteinyltransferase.	EC:2.3.2.15	-	90%
Blast2go	Glycine transaminase.	EC:2.6.1.4	-	90%

Source	KEGGs	Term	Type	e value	Identity
Blast2go	Glycine, serine and threonine metabolism	00260		0.0	90%
Blast2go	Metabolic pathways	01100		0.0	90%

Source	GOs	Term	Type	Identity
Blast2go	response to oxidative stress	GO:0006979	Biological Process	90%
Blast2go	1-aminocyclopropane-1-carboxylate biosynthetic process	GO:0042218	Biological Process	90%
Blast2go	glutathione catabolic process	GO:0006751	Biological Process	90%
Blast2go	photorespiration	GO:0009853	Biological Process	90%
Blast2go	alanine-glyoxylate transaminase activity	GO:0008453	Molecular Function	90%
Blast2go	gamma-glutamyltransferase activity	GO:0003840	Molecular Function	90%
Blast2go	1-aminocyclopropane-1-carboxylate synthase activity	GO:0016847	Molecular Function	90%
Blast2go	L-alanine:2-oxoglutarate aminotransferase activity	GO:0004021	Molecular Function	90%
Blast2go	glutathione gamma-glutamylcysteinyltransferase activity	GO:0016756	Molecular Function	90%
Blast2go	pyridoxal phosphate binding	GO:0030170	Molecular Function	90%
Blast2go	glycine:2-oxoglutarate aminotransferase activity	GO:0047958	Molecular Function	90%
Blast2go	peroxisome	GO:0005777	Cellular Component	90%
Blast2go	plant-type cell wall	GO:0009505	Cellular Component	90%
Blast2go	chloroplast stroma	GO:0009570	Cellular Component	90%
Blast2go	vacuole	GO:0005773	Cellular Component	90%
Blast2go	membrane	GO:0016020	Cellular Component	90%
Blast2go	apoplast	GO:0048046	Cellular Component	90%

Source	InterPros	Term	Type	Identity
Sma3	1-aminocyclopropane-1-carboxylate synthase	IPR001176	-	-
Sma3	Aminotransferase, class I/classII	IPR004839	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 1	IPR015421	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 2	IPR015422	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NXT3

Fln msg: Distance to subject end: 139 aas, your sequence is shorter than subject: 112 - 480

Fln protein: VVTLAVTHFCYVENLVLLADEVYQQNIYQDERPFVSAKKVLMDMGLPFSKELQLVSYHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASISLSPNVPGQVFLGLMVNP

Protein Length: 113

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTTTTGCTATGTTGAGAATCTGGTATTGTTAGCAGACGAGGTTTATCAACAAAATATTTATCAGGATGAGCGCCCCTTTGTAAGCGCAAAGAAGGTTTTGATGGACATGGGCTTACCTTTCAGCAAAGAACTCCAACTTGTGTCATATCATACTGTATCGAAAGGATACTGGGGTGAGTGTGGGCAGCGTGGAGGATATTTTGAAATGACAAACATTCCTCCTAAGACAGTTGATGAGATATATAAAGTGGCATCAATATCTCTAAGTCCTAATGTGCCCGGTCAAGTATTTCTAGGATTGATGGTTAATCCA

Fln Alignment:

uagpf_mira_rep_c39721___FCYVENLVLLADEVYQQNIYQDERPFVSAKKVLMDMGLPFSKELQLVSYHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASISLSPNVPGQVFLGLMVNP
A9NXT3________________FCYAENLVLLADEVYQQNIYQDERPFVSAKKVLMDMGLPFSKELQLVSYHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKVASISLSPNVPGQIFLGLMVNP

SNPs (tot: 8)

Position	A %	C %	G %	T %	Probability
58	66	33			0.997464
60	66			33	0.997464
63	66			33	0.997464
66		33	66		0.997464
67		33		66	0.997467
76	66			33	0.997476
77	66	33			0.997476
79	66	33			0.997476

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain