SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene40404

Length: 311 nt

UniGene Fasta

>uagpf_v2_unigene40404
CGTCGTGACCTTGGCTGTCACTCATTGCTGTGCCCAGTATCATTCACAGAGATATAAAGGCCAGTAATATTCTGTTCGTCGTGAGTTTGGCTGTTATTCGATTTTGGTCTGGCGAGGAATATAAATCCTCAAAAGAGTCATATATCTACCCAGGTAGCTGGGACACTGGGGTACATGCCTCCAGAATATTTTAATGGATCCATTGCTACGAAGCAAGCTGATGTTTACAGCGTTGGAATGTTGATGATGGAGATTGCCACTGGAAGGAGGCCTAATCTTTGTATCAAGGAGGATAGCCACAGGAGAACTCT

Ace file of the UniGene uagpf_v2_unigene40404

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene11682	1/2

Source	Descriptions	Term	Type	Identity
AutoFact	phytosulfokine receptor 2 [Arabidopsis thaliana] sp\|Q9FN37.1\|PSKR2_ARATH RecName: Full=Phytosulfokine receptor 2; Short=AtPSKR2; AltName: Full=Phytosulfokine LRR receptor kinase 2; Flags: Precursor dbj\|BAB10719.1\| receptor protein kinase-like protein [Ara	-	-	57%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	80%
Blast2go	protein	-	-	72%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases.	EC:2.7.11.-	-	0.0	72%

Source	GOs	Term	Type	Identity
Blast2go	protein phosphorylation	GO:0006468	Biological Process	72%
Blast2go	response to wounding	GO:0009611	Biological Process	72%
Blast2go	transmembrane receptor protein tyrosine kinase signaling pathway	GO:0007169	Biological Process	72%
Blast2go	protein serine/threonine kinase activity	GO:0004674	Molecular Function	72%
Blast2go	oxidoreductase activity	GO:0016491	Molecular Function	72%
Blast2go	ATP binding	GO:0005524	Molecular Function	72%
Blast2go	peptide receptor activity	GO:0001653	Molecular Function	72%
Blast2go	chloroplast	GO:0009507	Cellular Component	72%
Blast2go	plasma membrane	GO:0005886	Cellular Component	72%

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	Intradiol ring-cleavage dioxygenase, C-terminal	IPR000627	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Epidermal growth factor-like domain	IPR000742	-	-
Sma3	S-locus glycoprotein	IPR000858	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Bulb-type lectin domain	IPR001480	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Enolpyruvate transferase domain	IPR001986	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Glucose/ribitol dehydrogenase	IPR002347	-	-
Sma3	Dilute	IPR002710	-	-
Sma3	Apple-like	IPR003609	-	-
Sma3	Pistil-specific extensin-like protein	IPR003882	-	-
Sma3	Myosin, N-terminal, SH3-like	IPR004009	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Epidermal growth factor-like	IPR006210	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Leucine-rich repeat 2	IPR013101	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	PAN-2 domain	IPR013227	-	-
Sma3	Concanavalin A-like lectin/glucanase, subgroup	IPR013320	-	-
Sma3	Glycoside hydrolase, subgroup, catalytic domain	IPR013781	-	-
Sma3	SKG6/AXL2 alpha-helix transmembrane domain	IPR014805	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Interleukin-4/interleukin-13, conserved site	IPR018096	-	-
Sma3	Dil domain	IPR018444	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPH3

Fln msg: Separated hits, possible frame ERROR between 74 and 100, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 72 aas, your sequence is shorter than subject: 103 - 360

Fln protein: S*PWLSLIAVPSIIHRDIKASNIxxxxxxxxxxDFGLARNINPQKSHISTQVAGTLGYMPPEYFNGSIATKQADVYSVGMLMMEIATGRRPNLCIKEDSHRRT

Protein Length: 104

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTGCTGTGCCCAGTATCATTCACAGAGATATAAAGGCCAGTAATATTCTxxxxxxxxxxxxxxxxxxxxxxxxxxxCGATTTTGGTCTGGCGAGGAATATAAATCCTCAAAAGAGTCATATATCTACCCAGGTAGCTGGGACACTGGGGTACATGCCTCCAGAATATTTTAATGGATCCATTGCTACGAAGCAAGCTGATGTTTACAGCGTTGGAATGTTGATGATGGAGATTGCCACTGGAAGGAGGCCTAATCTTTGTATCAAGGAGGATAGCCACAGGAGAACTCT

Fln Alignment:

uagpf_mira_c37835___VPSIIHRDIKASNILxxxxxxxxxDFGLARNINPQKSHISTQVAGTLGYMPPEYFNGSIATKQADVYSVGMLMMEIATGRRP
B8LPH3________________IPHIIHRDIKSSNILxxxxxxxxxDFGLATLINPDQTHVSTIVAGTFGYLAPEYVETGRATEKGDVYSYGVVLLELITGKRP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain