UniGene Name: uagpf_v2_unigene39988
Length: 186 nt
UniGene Fasta |
---|
>uagpf_v2_unigene39988
C |
Ace file of the UniGene uagpf_v2_unigene39988 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene4780 | 2/3 |
SustainPine v2.0 | sp_v2.0_unigene28373 | 1/3 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | tRNA dimethylallyltransferase 2 [Arabidopsis thaliana] sp|Q9ZUX7.2|IPT2_ARATH RecName: Full=tRNA dimethylallyltransferase 2; AltName: Full=Isopentenyl-diphosphate: tRNA isopentenyltransferase 2; Short=AtIPT2; Short=IPP transferase 2; Short=IPPT 2 gb|AAF00 | - | - | 1.0e-36 | 40% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Blast2go | trna isopentenyltransferase | - | - | 0.0 | 65% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | tRNA dimethylallyltransferase. | EC:2.5.1.75 | - | 0.0 | 65% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Zeatin biosynthesis | 00908 | 0.0 | 65% | |
Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 65% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 65% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 65% | |
Blast2go | Adenylate dimethylallyltransferase. | EC:2.5.1.27 | - | 0.0 | 65% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Zeatin biosynthesis | 00908 | 0.0 | 65% | |
Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 65% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | cytokinin biosynthetic process | GO:0009691 | Biological Process | 0.0 | 65% |
Blast2go | tRNA processing | GO:0008033 | Biological Process | 0.0 | 65% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 65% |
Blast2go | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | 65% |
Blast2go | AMP dimethylallyltransferase activity | GO:0009824 | Molecular Function | 0.0 | 65% |
Blast2go | cytosol | GO:0005829 | Cellular Component | 0.0 | 65% |
Blast2go | tRNA dimethylallyltransferase activity | GO:0052381 | Biological Process | 0.0 | 65% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain C-terminal | IPR000668 | - | 0.0 | - |
Sma3 | tRNA isopentenyltransferase | IPR002627 | - | 0.0 | - |
Sma3 | Guanylate kinase | IPR008144 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Sma3 | tRNA delta(2)-isopentenylpyrophosphate transferase | IPR018022 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LNK3
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 355 aas, your sequence is shorter than subject: 61 - 462
Fln protein:
S
Protein Length:
62
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c37019___LSLIVGGSNSYIQALVSTVDDVMKNGDDDLKTSERPFGICSNAGSVNDLHKRCDNDV
B8LNK3________________LPIVVGGSNSYIQALACS-------GDDDLKTSKRPFSICSNAGNVNDLHKRCDNDV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain