|
||||||
|
UniGene Name: uagpf_v2_unigene39111
Length: 230 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene39111
C |
|
Ace file of the UniGene uagpf_v2_unigene39111
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene9643 | 3/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA-directed RNA polymerase n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RNX6_PHYPA | - | - | 0.0 | 82% |
| FL-Next | sp=DNA-directed RNA polymerase II subunit RPB2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 51% |
| Blast2go | protein | - | - | 0.0 | 83% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 0.0 | 83% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Purine metabolism | 00230 | 0.0 | 83% | |
| Blast2go | Pyrimidine metabolism | 00240 | 0.0 | 83% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 83% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | 83% |
| Blast2go | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | 83% |
| Blast2go | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | 83% |
| Blast2go | DNA binding | GO:0003677 | Molecular Function | 0.0 | 83% |
| Blast2go | ribonucleoside binding | GO:0032549 | Molecular Function | 0.0 | 83% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 83% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 83% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Leghaemoglobin | IPR001032 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase, subunit 2, domain 6 | IPR007120 | - | 0.0 | - |
| Sma3 | RNA polymerase, beta subunit, conserved site | IPR007121 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 7 | IPR007641 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 2 | IPR007642 | - | 0.0 | - |
| Sma3 | RNA polymerase, beta subunit, protrusion | IPR007644 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 3 | IPR007645 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 4 | IPR007646 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 5 | IPR007647 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, OB-fold | IPR014724 | - | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase, subunit 2 | IPR015712 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P38420
Fln msg: Distance to subject end: 648 aas, your sequence is shorter than subject: 76 - 1188
Fln protein:
V
Protein Length:
77
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c35227___VTQIVSRLSFIAALGHMTRISSQFEKTRKVSGPRALQPSQWGMLCPCDTPEGEACGLVKNLALMTHVT
P38420________________VSQVLNRLTYASTLSHLRRLNSPIGREGKLAKPRQLHNSQWGMMCPAETPEGQACGLVKNLALMVYIT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
