UniGene Name: uagpf_v2_unigene38898
Length: 180 nt
![]() |
---|
>uagpf_v2_unigene38898
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene27275 | 4/4 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | wall-associated kinase 4-like [Oryza sativa Japonica Group] dbj|BAG94677.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 0.0 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Blast2go | protein | - | - | 0.0 | 71% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | transferase activity | GO:0016740 | Molecular Function | 0.0 | 71% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPC1
Fln msg: Distance to subject end: 158 aas, your sequence is shorter than subject: 59 - 611
Fln protein:
V
Protein Length:
60
Fln nts:
C
Fln Alignment:
uagpf_mira_rep_c34791___LAVTHFLHRIDPPIFHRDVKSSNILLDENFNVKVADFGLCRIVPVNASHVTT
B8LPC1________________LAYLH--HEIQPGIIHRDIKASNILLDENFNARVADFGLAKFAPEGVSHLST
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain