SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene37949

Length: 553 nt

UniGene Fasta

>uagpf_v2_unigene37949
CGTCGTGACCTTGGCTGTCACTCAATTTTCAGTGAATTTAGCGGCGGGATTAAGCCAGCCGGTGCCGAAACCGGGTGGTATACTGGCTCCGGGGATGTGAAATACCACCTTGGGACTTCATATGACCGGCCGACGCGTCGTGACCTTGGCTGTCACTCAATCTCTCTCTGGTTGCCAATCCCAGCCATCTCGAGGCAGTGGATCCTGTCGTTATAGGAAAAACAAGGGCAAAGCAGTATTATTCTACCGACAAGGATCGGATAAAGAATATGGGGATTTTGATTCATGGAGACGGAAGTTTTGCCGGACAAGGGGTGGTTTACGAGACTTTGCATCTCAGTGCTTTGCCGAACTACACTACTGGCGGGACCATTCATATTGTGATTAATAATCAGGTTGCTTTCACTACTGATCCTGAATCTGGCAGATCCTCGCAGTATTGTACTGATGCCGCAAAGGCTTTGAGTGTGCCCATTTTCCATGTGAATGGCGATGATGTTGAAGCTGTCGTGCATGCATGTGTTCGCAGTGAGTGACAGGCCACTGAGACTGC

Ace file of the UniGene uagpf_v2_unigene37949

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene11470	3/4

Source	Descriptions	Term	Type	Identity
AutoFact	2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana] dbj\|BAB10682.1\| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana] gb\|AAL67070.1\| putative 2-oxoglutarate dehydrogenase E1 component [Arabidopsis thaliana] gb\|AAM20281.1\| put	-	-	80%
FL-Next	tr=2-oxoglutarate dehydrogenase, putative; Ricinus communis (Castor bean).	-	-	81%
Blast2go	2-oxoglutarate e1 component	-	-	89%

Source	ECs	Term	Type	e value	Identity
Blast2go	Oxoglutarate dehydrogenase (succinyl-transferring).	EC:1.2.4.2	-	0.0	89%

Source	KEGGs	Term	Identity
Blast2go	Citrate cycle (TCA cycle)	00020	89%
Blast2go	Lysine degradation	00310	89%
Blast2go	Tryptophan metabolism	00380	89%
Blast2go	Biosynthesis of phenylpropanoids	01061	89%
Blast2go	Biosynthesis of terpenoids and steroids	01062	89%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	89%
Blast2go	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	89%
Blast2go	Biosynthesis of alkaloids derived from histidine and purine	01065	89%
Blast2go	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	89%
Blast2go	Biosynthesis of plant hormones	01070	89%
Blast2go	Metabolic pathways	01100	89%
Blast2go	Biosynthesis of secondary metabolites	01110	89%

Source	GOs	Term	Type	Identity
Blast2go	response to cadmium ion	GO:0046686	Biological Process	89%
Blast2go	glycolysis	GO:0006096	Biological Process	89%
Blast2go	oxidation-reduction process	GO:0055114	Biological Process	89%
Blast2go	oxoglutarate dehydrogenase (succinyl-transferring) activity	GO:0004591	Molecular Function	89%
Blast2go	cobalt ion binding	GO:0050897	Molecular Function	89%
Blast2go	thiamine pyrophosphate binding	GO:0030976	Molecular Function	89%
Blast2go	zinc ion binding	GO:0008270	Molecular Function	89%
Blast2go	mitochondrion	GO:0005739	Cellular Component	89%

Source	InterPros	Term	Type	Identity
Sma3	Excinuclease ABC, C subunit, N-terminal	IPR000305	-	-
Sma3	Cytosolic fatty-acid binding	IPR000463	-	-
Sma3	Dehydrogenase, E1 component	IPR001017	-	-
Sma3	Transketolase-like, pyrimidine-binding domain	IPR005475	-	-
Sma3	2-oxoglutarate dehydrogenase, E1 component	IPR011603	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: B9SR46

Fln msg: Separated hits, possible frame ERROR between 138 and 156, Unexpected STOP codon at 3' end. Distance to subject end: 534 aas, your sequence is shorter than subject: 179 - 1021

Fln protein: RRDLGCHSIFSEFSGGIKPAGAETGWYTGSGDVKYHLGTSYDRPTxxxxxxxLNLSLVANPSHLEAVDPVVIGKTRAKQYYSTDKDRIKNMGILIHGDGSFAGQGVVYETLHLSALPNYTTGGTIHIVINNQVAFTTDPESGRSSQYCTDAAKALSVPIFHVNGDDVEAVVHACVRSE*

Protein Length: 180

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATTTTCAGTGAATTTAGCGGCGGGATTAAGCCAGCCGGTGCCGAAACCGGGTGGTATACTGGCTCCGGGGATGTGAAATACCACCTTGGGACTTCATATGACCGGCCGACGCGxxxxxxxxxxxxxxxxxxACTCAATCTCTCTCTGGTTGCCAATCCCAGCCATCTCGAGGCAGTGGATCCTGTCGTTATAGGAAAAACAAGGGCAAAGCAGTATTATTCTACCGACAAGGATCGGATAAAGAATATGGGGATTTTGATTCATGGAGACGGAAGTTTTGCCGGACAAGGGGTGGTTTACGAGACTTTGCATCTCAGTGCTTTGCCGAACTACACTACTGGCGGGACCATTCATATTGTGATTAATAATCAGGTTGCTTTCACTACTGATCCTGAATCTGGCAGATCCTCGCAGTATTGTACTGATGCCGCAAAGGCTTTGAGTGTGCCCATTTTCCATGTGAATGGCGATGATGTTGAAGCTGTCGTGCATGCATGTGTTCGCAGTGAGTGACAGGCCACTGAGACTGC

Fln Alignment:

uagpf_mira_rep_c32699___IFSEFSGGIKPAGAETGWYTGSGDVKYHLGTSYDRPTRxxxxxxLNLSLVANPSHLEAVDPVVIGKTRAKQYYSTDKDRIKNMGILIHGDGSFAGQGVVYETLHLSALPNYTTGGTIHIVINNQVAFTTDPESGRSSQYCTDAAKALSVPIFHVNGDDVEAVVHAC
B9SR46________________IFSEFSGGTKPVD-EVGLYTGTGDVKYHLGTSYDRPTRxxxxxxIHLSLVANPSHLEAVDPVVVGKTRAKQYYSNDEDRIKNMGILIHGDGSFAGQGVVYETLHLSALPNYSTGGTIHIVVNNQVAFTTDPTAGRSSQYCTDVAKALNAPIFHVNGDDVEAVVHAC

SNPs (tot: 9)

Position	A %	C %	G %	T %	Probability
194	75			25	0.996479
196	25		75		0.996479
198	75	25			0.996479
199			75	25	0.996479
203	66	33			0.997452
206		66		33	0.997452
208	33			66	0.997452
209		33	66		0.997452
227	66			33	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain