SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene37898

Length: 298 nt

UniGene Fasta

>uagpf_v2_unigene37898
ACAAGGGTTGAGTATGCGTCTTTACTTTGGTTGTCACTCCTCGGAGGAACTATCATGGCTCGAGAGAAAATACAGATAATCATTCCAGCAGATCTGTCCCAGAATACTTGGAGCAGAAAAAGATTCAAAAGCTCTTGTTACTTGGATATGAAGGCTCTGGCACTAGTACAATTTTCAAGCAGGCAAAATTTCTGTACAAGGATGAGAAATTTTCACAGGAGGAGCTGCAAAACATCAAACTGATGATACAGAGCAACCTATATAAATACCTTAGCATATTGCTTGAAGGGCGTGAGCG

Ace file of the UniGene uagpf_v2_unigene37898

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene1692	4/4

Source	Descriptions	Term	Type	Identity
AutoFact	XLG1, extra-large G protein n=2 Tax=Selaginella moellendorffii RepID=D8QZS9_SELML	-	-	54%
FL-Next	tr=GTP-binding protein alpha subunit, gna, putative; Ricinus communis (Castor bean).	-	-	68%
Blast2go	extra-large g protein	-	-	83%

Source	GOs	Term	Type	Identity
Blast2go	G-protein coupled receptor signaling pathway	GO:0007186	Biological Process	83%
Blast2go	signal transducer activity	GO:0004871	Molecular Function	83%
Blast2go	zinc ion binding	GO:0008270	Molecular Function	83%
Blast2go	GTP binding	GO:0005525	Molecular Function	83%

Source	InterPros	Term	Type	Identity
Sma3	Guanine nucleotide binding protein (G-protein), alpha subunit	IPR001019	-	-
Sma3	Aminoacyl-tRNA synthetase, class I, conserved site	IPR001412	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Plant G-protein, alpha subunit	IPR002976	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	G protein alpha subunit, helical insertion	IPR011025	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: B9T5D0

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 353 aas, your sequence is shorter than subject: 98 - 846

Fln protein: KG*VCVFTLVVTPRRNYHGSRENTDNHSSRSVPEYLEQKKIQKLLLLGYEGSGTSTIFKQAKFLYKDEKFSQEELQNIKLMIQSNLYKYLSILLEGRE

Protein Length: 99

Fln nts: ACAAGGGTTGAGTATGCGTCTTTACTTTGGTTGTCACTCCTCGGAGGAACTATCATGGCTCGAGAGAAAATACAGATAATCATTCCAGCAGATCTGTCCCAGAATACTTGGAGCAGAAAAAGATTCAAAAGCTCTTGTTACTTGGATATGAAGGCTCTGGCACTAGTACAATTTTCAAGCAGGCAAAATTTCTGTACAAGGATGAGAAATTTTCACAGGAGGAGCTGCAAAACATCAAACTGATGATACAGAGCAACCTATATAAATACCTTAGCATATTGCTTGAAGGGCGTGAGCG

Fln Alignment:

uagpf_mira_c32601___VCVFTLVVTPRRNYHGSRENTDNHSSRSVPEYXXXXXXXXXXXXGYEGSGTSTIFKQAKFLYKDEKFSQEELQNIKLMIQSNLYKYLSILLEGRE
B9T5D0________________ICSLFSLPVPPGNPLESKEDPTTFSSRSVPDYLEQGRVQKLLLLGLEGSGTSTIFKQAKFLYGN-KFTSEELQNIKLMIQSNMYKYLSILLEGRE

SNPs (tot: 10)

Position	A %	C %	G %	T %	Probability
21			50	50	1.0
23			50	50	1.0
26		50		50	1.0
27	50			50	1.0
29		50	50		1.0
31		50		50	1.0
34		50	50		1.0
35		50		50	1.0
39		50		50	1.0
41	50	50			1.0

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain

Position	A %	C %	G %	T %	Probability
21			50	50	1.0
23			50	50	1.0
26		50		50	1.0
27	50			50	1.0
29		50	50		1.0
31		50		50	1.0
34		50	50		1.0
35		50		50	1.0
39		50		50	1.0
41	50	50			1.0

Position	A %	C %	G %	T %	Probability
21			50	50	1.0
23			50	50	1.0
26		50		50	1.0
27	50			50	1.0
29		50	50		1.0
31		50		50	1.0
34		50	50		1.0
35		50		50	1.0
39		50		50	1.0
41	50	50			1.0

Position	A %	C %	G %	T %	Probability
21			50	50	1.0
23			50	50	1.0
26		50		50	1.0
27	50			50	1.0
29		50	50		1.0
31		50		50	1.0
34		50	50		1.0
35		50		50	1.0
39		50		50	1.0
41	50	50			1.0