SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene36764

Length: 487 nt

UniGene Fasta

>uagpf_v2_unigene36764
CGTCGTGACCTTGGCTGTCACTCAATTTAATGTCACAACGTTGGTTCACCCATGCTTCTCCTACACTTTTCAATGCTGGGACACCAAGGCCACAGTTGAGTAGTTGCTTCCTTGTTTGTCATGAAAGATGATAGCACTCTGAGGGGATATATGATACTCTAAAGGAATGTGCTATAATAAGCAAATCAGCTGGAGGACTTGGTGTTTCAGTACATAACATTCGTGCAACCAATAGTTATATCCGAGGAACTAATGGTACATCGAATGGTATTGTGCCAATGTTGAGGGTATTCAATGATACTGCTCGTTATGTTGATCAAGGTGGAGGCAAGAGGAAGGGTGCATTTGCCATGTACCTAGAGCCATGGCATGCAGATGTTTTCGAGTTTCTGGAGTTGAGAAAGACCATGGGAAGGAAGAGAACAGAGCACGTGATCTATTTTTTGCACTTTGGGTGCCAGACCTCTTTATGAAAAGGGTCCAGGAG

Ace file of the UniGene uagpf_v2_unigene36764

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene3341	6/6

Source	Descriptions	Term	Type	Identity
AutoFact	Ribonucleoside-diphosphate reductase n=1 Tax=Musa acuminata RepID=Q6RZW3_MUSAC	-	-	84%
FL-Next	sp=Ribonucleoside-diphosphate reductase large subunit; Arabidopsis thaliana (Mouse-ear cress).	-	-	81%
Blast2go	ribonucleoside-diphosphate reductase large subunit	-	-	92%

Source	ECs	Term	Type	e value	Identity
Blast2go	Ribonucleoside-diphosphate reductase.	EC:1.17.4.1	-	0.0	92%

Source	KEGGs	Term	Identity
Blast2go	Purine metabolism	00230	92%
Blast2go	Pyrimidine metabolism	00240	92%
Blast2go	Glutathione metabolism	00480	92%
Blast2go	Metabolic pathways	01100	92%

Source	GOs	Term	Type	Identity
Blast2go	oxidation-reduction process	GO:0055114	Biological Process	92%
Blast2go	deoxyribonucleoside triphosphate biosynthetic process	GO:0009202	Biological Process	92%
Blast2go	rRNA processing	GO:0006364	Biological Process	92%
Blast2go	DNA replication	GO:0006260	Biological Process	92%
Blast2go	chloroplast organization	GO:0009658	Biological Process	92%
Blast2go	response to cadmium ion	GO:0046686	Biological Process	92%
Blast2go	embryo development ending in seed dormancy	GO:0009793	Biological Process	92%
Blast2go	RNA binding	GO:0003723	Molecular Function	92%
Blast2go	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	GO:0004748	Molecular Function	92%
Blast2go	ATP binding	GO:0005524	Molecular Function	92%
Blast2go	3'-5'-exoribonuclease activity	GO:0000175	Molecular Function	92%
Blast2go	mitochondrion	GO:0005739	Cellular Component	92%
Blast2go	ribonucleoside-diphosphate reductase complex	GO:0005971	Cellular Component	92%
Blast2go	chloroplast	GO:0009507	Cellular Component	92%

Source	InterPros	Term	Type	Identity
Sma3	ATP-cone	IPR005144	-	-
Sma3	Ribonucleoside-diphosphate reductase, alpha subunit	IPR013346	-	-
Sma3	Ribonucleotide reductase large subunit, N-terminal	IPR013509	-	-
Sma3	Ribonucleotide reductase large subunit, C-terminal	IPR000788	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9SJ20

Fln msg: Overlapping hits, possible frame ERROR between 446 and 395, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 472 aas, your sequence is shorter than subject: 162 - 816

Fln protein: S*PWLSLNLMSQRWFTHASPTLFNAGTPRPQLSSCFLVCHER**HSEGIYDTLKECAIISKSAGGLGVSVHNIRATNSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAMYLEPWHADVFEFLxxxxxxxxxxxxxxxxxxxLWVPDLFMKRVQE

Protein Length: 163

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATTTAATGTCACAACGTTGGTTCACCCATGCTTCTCCTACACTTTTCAATGCTGGGACACCAAGGCCACAGTTGAGTAGTTGCTTCCTTGTTTGTCATGAAAGATGATAGCACTCTGAGGGGATATATGATACTCTAAAGGAATGTGCTATAATAAGCAAATCAGCTGGAGGACTTGGTGTTTCAGTACATAACATTCGTGCAACCAATAGTTATATCCGAGGAACTAATGGTACATCGAATGGTATTGTGCCAATGTTGAGGGTATTCAATGATACTGCTCGTTATGTTGATCAAGGTGGAGGCAAGAGGAAGGGTGCATTTGCCATGTACCTAGAGCCATGGCATGCAGATGTTTTCGAGTTTCTGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCTTTGGGTGCCAGACCTCTTTATGAAAAGGGTCCAGGAG

Fln Alignment:

uagpf_mira_rep_c29228___NLMSQRWFTHASPTLFNAGTPRPQLSSCFLVCHER**HSEGIYDTLKECAIISKSAGGLGVSVHNIRATNSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAMYLEPWHADVFEFLExxxxxxxxxxxxxxxxxxxWVPDLFMKRVQ
Q9SJ20________________HLMSQRWFTHASPTLFNAGTPRPQLSSCFLVCMKDD-SIEGIYETLKECAVISKSAGGIGVSVHNIRATGSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAVYLEPWHADVYEFLExxxxxxxxxxxxxxxxxxxWLPDLFMERVQ

SNPs (tot: 21)

Position	A %	C %	G %	T %	Probability
122		40		60	1.0
126	60		40		1.0
130	60	40			1.0
131	60	40			1.0
132			60	40	1.0
133	50			50	1.0
134			50	50	1.0
136	50	50			1.0
138	50		50		1.0
139			50	50	1.0
145	50			50	1.0
189	83			16	0.994515
190	83	16			0.994515
191	83		16		0.994515
193		83	16		0.994514
195		16	83		0.994514
202	80			20	0.995493
205		20	80		0.995493
209		20		80	0.995493
210	20		80		0.995493
392		66		33	0.997457

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain